KEGG   Streptomyces coelicolor: SCO1234Help
Entry
SCO1234           CDS       T00085                                 

Gene name
ureC
Definition
(RefSeq) urease subunit alpha
  KO
K01428  
urease subunit alpha [EC:3.5.1.5]
Organism
sco  Streptomyces coelicolor
Pathway
Arginine biosynthesis
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO1234 (ureC)
  Amino acid metabolism
   00220 Arginine biosynthesis
    SCO1234 (ureC)
  Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    SCO1234 (ureC)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     SCO1234 (ureC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1308254..1309975)
Genome map
AA seq 573 aa AA seqDB search
MPELSRTAYADLFGPTTGDRVRLADTDLFVEIEEDRSGGPGRSGDEAVFGGGKVLRESMG
QGRTTRAQGAPDTVITGALIIDHWGIVKADIGIRDGRITGIGKAGNPDTMDGVHPDLVIG
PETEIVAGNGKIVTAGGIDTHVHFIAPGAVDEALASGVTTLIGGGTGPAEGSKATTVTPG
AWHLAWMFAALESSPVNIGFLGKGSTMSKESMRDQLRAGVLGFKIHEDWGATPAVISACL
DVCEESGVQLAVHSDTLNEAGFVGDTFDAVAGRTLHAFHVEGAGGGHAPDMITAVSLPNM
LPASTNPTRPHTVNTVEEHLDMLMVCHHLNPAVPEDLAFAESRIRPSTIAAEDILHDMGA
ISIMSSDAQAMGRIGEVILRTWQTAHVMKRRRGFLPGDTRADNLRARRYVAKYTINPAVA
QGIEHEVGSVETGKLADLVLWDPRFFGAKPQLVIKGGQIAYAQMGDANASIPTPQPVLPR
PMYGALGTAPATNSVNFVSEQAVEDGLPERLGLGRAFVPIRSTRGRTKADMRQNDALPRV
EVAADSFAVTIDGELVEPAPVTELPLAQRYFLF
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactgtcccgcaccgcctacgccgacctgttcggcccgaccaccggcgaccgc
gtccgcctcgccgacaccgacctcttcgtcgagatcgaggaggaccgctccggcggtccg
ggccgctccggcgacgaagccgtcttcggcggcggcaaggtgctgcgcgagtccatgggg
caggggcgcaccacccgtgcccagggtgctcccgacaccgtgatcaccggagccctgatc
atcgatcactgggggatcgtcaaggccgacatcggcatccgcgacggacggatcaccggc
atcggcaaggccgggaacccggacaccatggacggtgtccaccccgacctcgtcatcggc
cccgagacggagatcgtcgcgggcaacggcaagatcgtcaccgcgggcggaatcgacacc
cacgtccacttcatcgcgccgggcgccgtcgacgaggccctggcatccggcgtgaccact
ctcatcggcggcggcaccggcccggccgagggcagcaaggcgaccaccgtcacgcccggc
gcctggcatctcgcgtggatgttcgccgccctggagtccagccccgtcaacatcggcttc
ctcggcaagggcagcaccatgtcgaaggagtccatgcgcgaccagctgcgggccggcgtc
ctcggcttcaagatccacgaggactggggcgcgacccccgccgtcatctccgcctgcctg
gacgtgtgcgaggagtccggcgtccagctggccgtccactccgacaccctgaacgaggcc
ggcttcgtcggcgacaccttcgacgcggtcgcgggccgcaccctgcacgccttccacgtc
gagggcgccggcggcggccacgcacctgacatgatcacggcggtatcgctgcccaacatg
ctgccggcgtccaccaaccccacccggccgcacaccgtcaacaccgtcgaggaacacctc
gacatgctgatggtgtgccaccacctcaacccggccgtccccgaggacctggccttcgcc
gagtcccggatccggcccagcaccatcgcggccgaggacatcctgcacgacatgggggcg
atctccatcatgtcgtcggacgcccaggccatggggcgcatcggcgaggtgatcctgcgg
acctggcagaccgcgcacgtgatgaagcgccggcgcggcttcctgcccggcgacacccgc
gcggacaacctccgtgcccgtcgctatgtcgccaagtacaccatcaaccccgcggtcgcc
cagggcatcgagcacgaggtcggctccgtcgagaccggcaagctcgccgacctggtgctc
tgggacccccgcttcttcggcgcgaagccgcagctcgtcatcaagggcggccagatcgcg
tacgcgcagatgggcgacgccaacgcctccattcccacgccgcagccggtgctgccgcgc
ccgatgtacggggcgctgggaaccgctcccgccaccaactcggtcaacttcgtctccgag
caggccgtcgaggacgggcttccggaacggctcgggctcgggcgggcgttcgtgcccatc
cggtccacacgcggccggaccaaggccgacatgcggcagaacgacgcgctgccccgcgtg
gaggtcgccgcggactccttcgcggtgaccatcgacggcgaactcgtcgaacccgctccc
gtcaccgaactgccgctggcccagcggtacttcctcttctga

DBGET integrated database retrieval system