KEGG   Streptomyces coelicolor: SCO1254Help
Entry
SCO1254           CDS       T00085                                 

Gene name
2SCG1.29, 2SCG18.01, purB
Definition
(RefSeq) adenylosuccinate lyase
  KO
K01756  
adenylosuccinate lyase [EC:4.3.2.2]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO1254 (2SCG1.29)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO1254 (2SCG1.29)
Enzymes [BR:sco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     SCO1254 (2SCG1.29)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
1325285..1326727
Genome map
AA seq 480 aa AA seqDB search
MTSAPAKPRIPNVLAGRYASAELATLWSPEHKVKLERQLWLAVLRAQKDLGIEVPDAAIA
DYERVLNQVDLASIAEREKVTRHDVKARIEEFNDLAGHEHVHKGMTSRDLTENVEQLQIR
LSLELVRDRSVAVLARLGKLAGEYGELVMAGRSHNVAAQATTLGKRFASAADELLVAYGR
VEELLGRYPLRGIKGPVGTAQDMLDLLGGDAGKLADLEQRIAGHLGFSQAFTSVGQVYPR
SLDYEVVTALVQLAAAPSSLAKTIRLMAGHELVTEGFKPGQVGSSAMPHKMNTRSCERVN
GLTVILRGYASMTGELAGDQWNEGDVSCSVVRRVALPDAFFALDGLLETFLTVLDEFGAF
PAVVARELDRYLPFLATTKVLMGAVRGGVGREVAHEAIKENAVASALAMREQGAERNELL
DKLAADDRIPLDRAALDALMADKLSFTGAAADQVGVVVGRIEDIVKRHPQAAGYTPGAIL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgacttccgctcccgccaagccccgcatcccgaacgtcctcgccggacgctacgcctcc
gccgagctcgccaccctctggtcgcccgagcacaaggtgaagctcgagcggcagctctgg
ctcgccgtgctgcgggcccagaaggacctgggcatcgaggtgcccgacgccgcgatcgcc
gactacgagcgcgtcctcaaccaggtcgacctggcctcgatcgccgagcgcgagaaggtc
acgcggcacgacgtgaaggcgcggatcgaggagttcaacgacctcgccgggcacgagcac
gtccacaagggcatgacctcccgcgacctgacggagaacgtcgagcagctccagatccgg
ctctcgctggagctggtccgggaccgttccgtggccgtcctggcccgcctcggcaagctg
gccggcgagtacggcgagctggtcatggccggccgctcgcacaacgtggcggcgcaggcg
acgacgctgggcaagcggttcgccagcgccgccgacgagctgctcgtggcgtacggccgg
gtggaggagctgctcggccgctacccgctgcgcggcatcaagggcccggtcggcaccgcc
caggacatgctggacctgctcggcggtgacgcgggcaagctggcggacctggagcagcgg
atcgccgggcacctcggcttctcgcaggcgttcacctcggtcggccaggtgtacccgcgc
tccctggactacgaggtcgtcaccgcgctggtgcagctcgccgccgcgccgtcctcgctg
gccaagacgatccgcctgatggccgggcacgagctggtcaccgagggcttcaagcccggc
caggtcggctcgtccgcgatgccgcacaagatgaacacccgttcctgcgagcgcgtcaac
ggcctgacggtgatcctgcgcggctacgcctcgatgaccggtgagctggcgggcgaccag
tggaacgagggcgacgtgtcctgctcggtggtgcgccgggtggcgctccccgacgccttc
ttcgcgctggacgggctgctggagacgttcctgaccgtgctcgacgagttcggcgccttc
ccggccgtcgtggcccgggagctggaccgctacctgccgttcctggccaccaccaaggtg
ctgatgggcgcggtgcgcggcggtgtgggccgcgaggtcgcgcacgaggcgatcaaggag
aacgcggtcgcctccgcgctggccatgcgcgagcagggcgccgagcgcaacgagctgctc
gacaagctggccgccgacgaccgcatcccgctggaccgtgccgccctggacgcgctgatg
gccgacaagctctccttcaccggcgccgcggccgaccaggtcggtgtggtcgtcggccgg
atcgaggacatcgtcaagcggcacccgcaggccgccggttacacccccggagcgatcctc
tga

DBGET integrated database retrieval system