KEGG   Streptomyces coelicolor: SCO1294Help
Entry
SCO1294           CDS       T00085                                 

Gene name
SCBAC36F5.05c
Definition
(RefSeq) cystathionine gamma-synthase
  KO
K01761  
methionine-gamma-lyase [EC:4.4.1.11]
Organism
sco  Streptomyces coelicolor
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO1294 (SCBAC36F5.05c)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO1294 (SCBAC36F5.05c)
Enzymes [BR:sco01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     SCO1294 (SCBAC36F5.05c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1368938..1370161)
Genome map
AA seq 407 aa AA seqDB search
MDSARTHTSPPDDVRFTAPAGRALATEAVHAGRDDLAAQGLHAPPIDLSTTYPSYDSRGE
AARIDAFAATGAEPDGPPVYGRLGNPTVARFETALARLEGTEAAVAFASGMAALSAVLLV
RGSMGLRHVVAVRPLYGCSDHLLTAGLLGSEVTWTDPAGVADALRPDTGLVLVESPANPT
LAEVDLRAVAHACGSVPLLVDNTFATPVLQRPAEHGARLVLHSATKYLGGHGDVLAGVVA
CDEEFAGRLRQVRFATGGVLHPLAGYLLLRGLSTLPVRVRAASANAADLAGRLAADPRVA
RVHYPRIGGAMVSFEVHGDPHAVIGGVRLITPAVSLGSVDTLIQHPASISHRIVDADDRR
GAGVGDRLLRLSVGLEDVDDLWADLDRALGERAAGAVSPREALSRAD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggactcagcgcgcacgcacacgtcaccacccgacgacgtacgcttcaccgcacccgcg
ggcagggcactggccaccgaagccgtgcacgccggccgcgacgacctcgccgcccaggga
ctgcacgccccgcccatcgacctgtccacgacctacccgtcgtacgacagccgcggcgag
gccgcccgcatcgacgcgttcgccgcgaccggtgccgagccggacgggccgcccgtctac
ggccgcctcggcaacccgaccgtcgcccgcttcgagacggcactggcccggctggagggg
acggaggccgcagtcgccttcgccagcggcatggccgcgctgagcgccgtactgctggtc
cgcggctcgatggggctccgtcacgtcgtcgccgtacggcccctgtacggctgcagcgac
cacctgctgaccgccgggctgctcgggtccgaggtcacctggaccgacccggcgggcgtc
gccgacgcgctgcgcccggacaccggactggtgctcgtggagtcgccggccaacccgacg
ctggccgaggtcgacctgcgggccgtcgcccacgcctgcgggtcggtgccgctgctcgtg
gacaacaccttcgccacgcccgtgctccagcgccccgccgagcacggggcccggctggtg
ctgcacagcgccaccaagtacctgggcgggcacggggacgtactggcgggcgtggtcgcc
tgcgacgaggagttcgccgggcggctgcggcaggtccgcttcgccacgggcggagtgctg
cacccgctggccggctacctcctgctgcgtgggctgtccaccctgcccgtgcgggtacgg
gccgcctccgccaacgccgccgacctggccgggcggctggccgccgacccgcgggtggcc
cgcgtccactacccgcgcatcggcggtgcgatggtctccttcgaggtccacggcgacccg
cacgcggtcatcggcggcgtccggctgatcaccccggccgtgagcctcggcagcgtcgac
acgctcatccagcacccggcgtcgatcagccaccgcatcgtggacgcggacgaccggcgg
ggggccggggtcggcgaccggctgctgcggctgtcggtcggcctggaggacgtcgacgac
ctgtgggccgacctggaccgggccctgggggagcgggcggccggggccgtctcgccgcgg
gaggcgctgtcgcgggccgactga

DBGET integrated database retrieval system