KEGG   Streptomyces coelicolor: SCO1378Help
Entry
SCO1378           CDS       T00085                                 

Gene name
SC10A9.20c
Definition
(RefSeq) glycine dehydrogenase
  KO
K00281  
glycine dehydrogenase [EC:1.4.4.2]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO1378 (SC10A9.20c)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO1378 (SC10A9.20c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     SCO1378 (SC10A9.20c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1454780..1457665)
Genome map
AA seq 961 aa AA seqDB search
MTAHRTPLSELEQAMPFEQRHIGPDHEARAKMLAQVGYGSLDELTAAAVPDVIKNADRLD
LPGARSEAEVLAELRSLADRNQVLDSMIGLGYYGTFTPPVILRNVMENPAWYTAYTPYQP
EISQGRLEALLNFQTMVAELTGLPTSGASLLDEGTAAAEAMALSRRMGKNKKGLFLVDAD
ALPQTVAVIRTRAEPTGVEVVVADLSEGIPAEVAEREINGVLLQYPGASGAVRDIKPVID
RAHELGALVTVAADLLALTLLTSPGELGADIAVGTTQRFGVPMGFGGPHAGYMAVHEKFA
RSLPGRLVGVSVDADGNKAYRLALQTREQHIRREKATSNICTAQVLLAVMAGMYAVYHGP
EGLRAIARRTHRYATITAAGLAAGGVEIVHGSYFDTVTARVPGRAAGIVHAARENGINLR
LVDADHVSFACDETTTRAQVGGVWHAFGVEGDIESLDAEAGETLPEALLRTDDFLTHPVF
HQHRSETAMLRYLRRLADRDYALDRGMIPLGSCTMKLNATTEMEPVTWPEFGALHPFAPA
EQAQGYLTLIRELEERLAEVTGYDKVSLQPNAGSQGEFAGLLAVRGYHRANGDEQRTVCL
IPSSAHGTNAASAVMAGMKVVVVKTAEDGEIDVEDLRAKIDKHRDELAVLMITYPSTHGV
FEEHVADICAQVHDAGGQVYVDGANLNALVGLAKPGHFGGDVSHLNLHKTFCIPHGGGGP
GVGPVGVRSHLAPYLPNHPLQPAAGPQTGVGPISAAPWGSAGILPISWSYVRLMGGEGLK
RATQVAVLSANYIAKRLEPHFPVLYNGPGGLVAHECIIDLRPLTKATGVSVDDVAKRLID
YGFHAPTMSFPVAGTLMIEPTESEDLAELDRFCEAMIAIRAEIEKVGSGAWPADDNPLRG
APHTADALGGEWDHAYTREEAVFPAGVSAADKYWPPVRRIDQAYGDRNLVCSCPPLDAYE
D
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccaccgcactccgctctccgaactcgaacaggccatgcccttcgagcagcgc
cacatcggccccgatcacgaggcccgggccaagatgctcgcgcaggtcggttacggttcg
ctcgacgaactgacggccgccgcggtgccggatgtgatcaagaacgccgaccggctggat
ctgccgggcgcgcgctccgaggccgaggtgctggccgagctgcgctccctggccgaccgc
aaccaggtcctcgactccatgatcggcctcggctactacggcaccttcaccccgccggtc
atcctgcgcaacgtcatggagaacccggcctggtacacggcgtacacgccctaccagccg
gagatctcccagggccgtctcgaagccctgctgaacttccagacgatggtcgccgagctc
accggactgcccacctccggcgcctcgctgctcgacgagggcaccgccgccgccgaggcg
atggccctctcccggcgcatgggcaagaacaagaagggcctgttcctggtcgacgcggac
gccctgccgcagaccgtcgccgtgatacggacccgcgccgagccgaccggcgtcgaggtc
gtcgtcgccgacctgagcgagggcatccccgccgaggtcgccgagcgcgagatcaacggc
gtcctgctccagtacccgggcgcctccggagccgtccgcgacatcaagccggtgatcgac
cgggcgcacgaactcggcgcgctcgtcaccgtcgccgccgacctgctcgccctcaccctg
ctcacctcgcccggcgagctgggcgcggacatcgcggtgggcaccacccagcgcttcggc
gtgccgatgggcttcggcggaccgcacgccggctacatggcggtgcacgagaagttcgcc
cgcagcctccccggccgcctggtcggcgtctccgtcgacgccgacggcaacaaggcctac
cgcctggctctgcagacccgcgagcagcacatccgccgcgagaaggccaccagcaacatc
tgcaccgcgcaggtgctgctcgccgtcatggccggcatgtacgccgtctaccacggcccc
gagggcctgcgggccatcgcccgccgaacccaccggtacgccacgatcaccgccgccggc
ctcgccgcgggcggcgtcgagatcgtccacggctcctacttcgacaccgtcaccgcgcgg
gtgcccggccgggccgccgggatcgtgcacgccgcccgcgagaacggcatcaacctgcgg
ctcgtcgacgccgaccacgtgtcgttcgcctgcgacgagaccaccacgcgcgcccaggtc
ggcggcgtgtggcacgccttcggcgtggagggcgacatcgagtcgctggacgcggaggcc
ggggagacgctgcccgaggcgctgctgcgcaccgacgacttcctcacccaccccgtcttc
caccagcaccgctccgagaccgcgatgctgcgctacctgcgccgcctcgccgaccgggac
tacgcgctggaccgcggcatgatcccgctgggctcctgcaccatgaagctcaacgcgacc
accgagatggagccggtcacctggcccgagttcggcgcgctgcaccccttcgcgcccgcc
gagcaggcgcagggctacctcaccctcatccgcgagctggaggagcggctcgccgaggtc
accgggtacgacaaggtctcgctccagccgaacgccgggtcgcagggcgagttcgcgggc
ctgctcgccgtacgcggctaccaccgggccaacggcgacgagcagcgcaccgtctgcctc
atcccgtcctcggcgcacggcaccaacgccgccagcgccgtgatggccggcatgaaggtc
gtcgtcgtcaagaccgccgaggacggcgagatcgacgtcgaggacctgcgcgccaagatc
gacaagcaccgcgacgagctggccgtgctgatgatcacctacccgtccacgcacggcgtg
ttcgaggagcacgtcgccgacatctgcgcgcaggtgcacgacgcgggcggccaggtctac
gtggacggcgccaacctcaacgccctggtcggcctcgccaagcccggccacttcggcggc
gacgtctcccacctgaacctgcacaagaccttctgcatcccgcacggcggcggcggcccc
ggcgtgggccccgtcggcgtacggtcgcacctggcgccgtacctgcccaaccacccgctg
cagcccgcggccggtccgcagacgggcgtcggcccgatctcggcggcgccgtggggctcg
gccggcatcctgccgatctcctggtcctacgtccgcctgatgggcggcgagggcctcaag
cgcgccacgcaggtcgccgtgctgtccgccaactacatcgccaagcgcctggagccgcac
ttcccggtgctctacaacggccccggcgggctggtcgcgcacgagtgcatcatcgacctg
cgcccgctgaccaaggccaccggcgtgagcgtcgacgacgtcgccaagcggctgatcgac
tacggcttccacgcgccgacgatgtccttcccggtggccggcacgctgatgatcgagccg
accgagtccgaggacctggccgagctggaccggttctgcgaggcgatgatcgccatccgc
gcggagatcgagaaggtcggctccggcgcctggcccgccgacgacaacccgctgcgcggc
gccccgcacaccgcggacgcgctcggcggtgagtgggaccacgcgtacacccgcgaggag
gccgtcttcccggccggggtgtccgccgccgacaagtactggccgccggtgcgccgcatc
gaccaggcctacggcgaccggaacctggtctgctcctgcccgccgctggacgcgtacgag
gactga

DBGET integrated database retrieval system