KEGG   Streptomyces coelicolor: SCO1380Help
Entry
SCO1380           CDS       T00085                                 

Gene name
SC10A9.22c
Definition
(RefSeq) DNA polymerase IV
  KO
K02346  
DNA polymerase IV [EC:2.7.7.7]
Organism
sco  Streptomyces coelicolor
Brite
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SCO1380 (SC10A9.22c)
DNA repair and recombination proteins [BR:sco03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    SCO1380 (SC10A9.22c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(1458383..1459822)
Genome map
AA seq 479 aa AA seqDB search
MRTAPTILHLDMDAFFASVEQASKPSLRGKAVVVGGLGPRGVVATCSYEARVFGVHSAMP
MGQARRLAPHAAYLVPRFELYRSISEQVMRLLRELSPLVEPLSLDEAFVDLDAGGAARDA
ETARLAGTKLRTDIRTVTGLTGSVGLAASKMLAKIASEAAKPDGLVLIPPGTERAMLEPM
TVRTLPGVGPATGDHLRRAGITTVGEIAEAGEDELVRLLGKAHGHALYAMALARDERPVV
AERETKSVSVEDTYDVDIHDRVRVGVEVGRLADRCVRRLRASGLSGRTIVLKVRRYDFST
LTRSETLRGPTDDPAVVREAAARLLDSVDTTGGVRLLGVGVSGLADYTQEDLFAQAAGDR
AEEPAEEPGTEPAEAHSPSPAERRWPSGHDVRHTELGHGWVQGSGLGRVTVRFETPYSGV
GRVRTFLVDDPELTPADPLPLVADTEGGAGQPSSGPLPLPASLPKSWSGGGGAAATSRP
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaccgcgcccacgatcctgcatctcgacatggacgccttcttcgcctcggtggag
caggcgtccaagccgagcctgcgtgggaaggccgtcgtggtgggcggcctcggaccgcgc
ggcgtggtcgccacctgctcgtacgaggcgcgggtgttcggggtgcactccgcgatgccg
atgggccaggcccgccggctcgcgccgcacgccgcctacctcgtgccgcgcttcgagctc
taccggtcgatcagcgagcaggtgatgcggctgctgcgggagctgtcgccgctggtcgag
ccgctgagcctggacgaggccttcgtggacctggacgccggcggggcggcccgggacgcg
gagacggcgcgactggccgggacgaagctgcgcacggacatccgcaccgtcaccggcctc
accgggtccgtgggcctcgcagcctccaagatgctcgccaagatcgcctcggaggcggcc
aagcccgacggactggtgctcatcccgccggggaccgagcgcgccatgctggagccgatg
acggtgcggacgctgcccggggtgggaccggccacgggagaccacctgcggcgggccggg
atcaccacggtcggcgagatcgccgaggcgggcgaggacgagctggtgcggctgctgggc
aaggcgcacggccacgccctgtacgccatggcgctggcgcgggacgagcggccggtggtg
gccgagcgggagaccaagtcggtgtcggtcgaggacacctacgacgtggacatccacgac
cgggtgcgggtcggcgtcgaggtggggcggctggcggaccggtgcgtgcggcggctgcgc
gcctccggactgtccgggcggaccatcgtgctcaaggtgcgcagatacgacttctccacg
ctcacgcgctccgagaccttgcgcggccccaccgacgaccccgcggtggtgcgggaggcg
gcggccagactgctggactcggtggacaccacgggcggcgtgcggctgctcggggtgggt
gtcagcgggctcgccgactacacgcaggaggacctgttcgcgcaggcggcgggggaccgg
gcggaggaaccggccgaggagcccgggaccgagcccgccgaggcgcacagcccctcgccc
gccgagcgccggtggccgtcggggcacgacgtgcggcacacggagctggggcacggctgg
gtccagggcagcggtctcggacgggtcaccgtgcgcttcgagacgccgtactcgggggtc
gggcgggtgcggaccttcctggtggacgacccggagctgacaccggcggatccactgccg
ctggtcgccgacacggagggcggggcgggtcagccctcgtcgggccccttgcccttgccg
gccagcttgccgaagtcgtggtcgggaggcgggggagcggccgccacgtcgaggccgtag

DBGET integrated database retrieval system