KEGG   Streptomyces coelicolor: SCO1388Help
Entry
SCO1388           CDS       T00085                                 

Gene name
SC1A8A.08c
Definition
(RefSeq) mannose-1-phosphate guanyltransferase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
sco  Streptomyces coelicolor
Pathway
sco00051  Fructose and mannose metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SCO1388 (SC1A8A.08c)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO1388 (SC1A8A.08c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     SCO1388 (SC1A8A.08c)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     SCO1388 (SC1A8A.08c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase PGM_PMM_II Hexapep NTP_transf_3 PGM_PMM_I PGM_PMM_III IspD
Motif
Other DBs
NCBI-GeneID: 1096811
NCBI-ProteinID: NP_625671
Kitasato: SCO1388
UniProt: Q9KZP4
Position
complement(1465266..1467761)
Genome map
AA seq 831 aa AA seqDB search
MKAVVMAGGEGTRLRPMTSSMPKPLLPVVNRPIMEHVLRLLKRHGLNETVVTVQFLASLV
KNYFGDGEELGMELTYANEEKPLGTAGSVKNAEEALKDDAFLVISGDALTDFDLTDLINF
HKEKGSLVTVCLTRVPNPLEFGITIVDEEGKVERFLEKPTWGQVFSDTVNTGIYVMEPEV
FNYVDPDVPVDWSGDVFPQLMKEGKPIYGYVAEGYWEDVGTHESYVKAQADVLERKVDVD
IDGFEISPGVWVAEGAEVHPDAVLRGPLYVGDYAKVEAGAEIREHTVIGSNVVVKSGAFL
HKAVVADNVYVGPHSNLRGCVVGKNTDIMRAARIEDGAVIGDECLVGEESIIQGNVRVYP
FKTIEAGAFVNTSVIWESRGQAHLFGARGVSGILNVEITPELAVRLAGAYATTLKKGSTV
TTARDHSRGARALKRAVISALQASAIDVRDLENVPLPVARQQTARGSAGGIMIRTTLGVP
DSVDIMFFDGQGADLSQGSQRKLDRVFARQEYRRAFPGEIGDLHFPSSVFDSYTGSLLRN
VDITGIAESGLKVVVDASNGSAGLVLPSLLGKLGVDSLTINPGLDEARPTESADMRRSGL
VRLGEIVASSRAAFGVRFDPVGERLSLVDEKGRIIEDDRALLVMLDLIAAERRSGRVALP
VTTTRIAEQVAAYHGTQVEWTTTSPDDLTRVGGEEGAIFGGDGKGGFIVPEFSSVYDGTA
AFVRLIGLVARTQLTLSQIDARIPRAHVLKRDLATPWAVKGLVMRRVVEAAGDRFVDTTD
GVRVVETDGRWVMVLPDPAEAVTHLWAEGPDDASAQALLDEWAAVVDSAGR
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtcgtgatggctggaggcgaaggcacacgccttcgtcccatgacctcgagc
atgcccaagccgctcctgccggtggtcaaccggccgatcatggagcatgttcttcggctg
ctcaaaaggcatgggctcaacgagaccgtcgtgaccgtccagttcctggcctcactggtc
aagaactacttcggtgacggcgaggagctcggaatggagctcacctatgccaacgaggag
aagccactcggtaccgccggaagcgtcaagaacgccgaggaggcattgaaggacgatgcc
ttcctcgtcatttccggcgatgccctgaccgacttcgacctcaccgatctgatcaacttc
cacaaggaaaagggctcgctcgtcaccgtgtgtctgacgcgcgtgcccaacccgctggaa
ttcggtatcaccatcgtcgacgaagagggcaaggtcgagcgcttcctggagaagccgacc
tggggccaggtcttctcggacaccgtgaacaccggcatctacgtcatggagcccgaggtc
ttcaactatgtcgaccccgatgtgcccgtggactggtccggtgacgtcttcccgcagttg
atgaaggaaggcaagcccatctacggctatgtcgccgagggctactgggaggacgtcggt
acccatgagagctatgtgaaggcccaggccgacgttctggaacgcaaggtcgacgtcgac
atcgacggcttcgagatctcgcccggcgtctgggtggccgagggtgcggaggtgcatccc
gacgcggtgctgcgcggacccctctacgtcggcgactacgcgaaggtcgaggccggcgcg
gagatccgcgaacacacggtgatcgggtccaacgtcgtcgtcaagagcggcgccttcctg
cacaaggccgtggtcgccgacaacgtgtacgtcggcccgcacagcaatctgcgcggctgt
gtggtcggcaagaacaccgacatcatgcgcgccgcgcggatcgaggacggcgcggtcatc
ggcgacgaatgcctggtcggtgaagaatcgatcatccagggcaatgtgcgggtctacccg
ttcaagaccatcgaggcaggcgcgttcgtcaacacctcggtgatctgggaatcccgcggg
caggcgcatctcttcggtgcgcgcggggtctccggcatcctcaacgtggagatcaccccg
gagctggccgtgcggctggccggtgcgtacgcgacgaccctgaagaaggggtccaccgtc
accacggcccgtgaccactcccgtggcgcccgggcgctgaagcgggcggtgatctccgcg
ctgcaggccagcgccatcgacgtacgcgacctggagaacgtacccctgcccgtggcgcgg
cagcagaccgcgcggggcagcgccggcgggatcatgatccggaccaccctcggggtgccg
gactccgtcgacatcatgttcttcgacggccagggcgccgacctctcgcagggcagccag
cgaaagctggaccgggtcttcgcgcgccaggagtaccggcgggcgttccccggcgagatc
ggggacctgcacttcccgtccagcgtgttcgactcctacaccgggtccctgctgcgcaac
gtcgacatcaccggcatcgcggagtccgggctcaaggtggtcgtcgacgcctccaacggc
agcgcgggactggtgctgccgagcctgctcgggaagctcggcgtcgactccctgacgatc
aatcccggtctcgacgaggccaggcccaccgagtcggccgacatgcggcggtccggtctg
gtgcgcctcggggagatcgtggcgtcctcgcgggccgcgttcggcgtgcggttcgacccc
gtcggtgaacggctgtcgctcgtcgacgagaagggccgcatcatcgaggacgaccgggcg
ctgctggtgatgctcgacctgatcgcggccgagcggcgcagcggccgggtggcgctcccg
gtgaccaccaccaggatcgccgagcaggtcgccgcgtaccacggcacgcaggtcgagtgg
acgaccacctccccggacgatctgacgcgggtggggggcgaggaaggcgcgatcttcggc
ggagacggcaagggcggcttcatcgtccccgagttcagcagtgtgtacgacggcacggcg
gccttcgtgcggctgatcggactggtcgcgcgcacgcagctcacgctgagccagatcgac
gcgcggatcccgcgggcccacgtcctcaagcgcgatctggccactccgtgggcggtcaag
ggcctggtgatgcggcgggtcgtcgaggcggccggagaccggttcgtggacaccacggac
ggggtgcgggtggtcgagaccgacgggcgctgggtgatggtcctgcccgaccccgcggag
gcggtcacccatctgtgggcggagggccccgacgacgcctccgcacaggcgctgctggac
gagtgggccgcggtggtggacagcgcgggccgctga

DBGET integrated database retrieval system