KEGG   Streptomyces coelicolor: SCO1388Help
Entry
SCO1388           CDS       T00085                                 

Gene name
SC1A8A.08c
Definition
(RefSeq) mannose-1-phosphate guanyltransferase
  KO
K16881  
mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
sco  Streptomyces coelicolor
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SCO1388 (SC1A8A.08c)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO1388 (SC1A8A.08c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     SCO1388 (SC1A8A.08c)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     SCO1388 (SC1A8A.08c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(1465266..1467761)
Genome map
AA seq 831 aa AA seqDB search
MKAVVMAGGEGTRLRPMTSSMPKPLLPVVNRPIMEHVLRLLKRHGLNETVVTVQFLASLV
KNYFGDGEELGMELTYANEEKPLGTAGSVKNAEEALKDDAFLVISGDALTDFDLTDLINF
HKEKGSLVTVCLTRVPNPLEFGITIVDEEGKVERFLEKPTWGQVFSDTVNTGIYVMEPEV
FNYVDPDVPVDWSGDVFPQLMKEGKPIYGYVAEGYWEDVGTHESYVKAQADVLERKVDVD
IDGFEISPGVWVAEGAEVHPDAVLRGPLYVGDYAKVEAGAEIREHTVIGSNVVVKSGAFL
HKAVVADNVYVGPHSNLRGCVVGKNTDIMRAARIEDGAVIGDECLVGEESIIQGNVRVYP
FKTIEAGAFVNTSVIWESRGQAHLFGARGVSGILNVEITPELAVRLAGAYATTLKKGSTV
TTARDHSRGARALKRAVISALQASAIDVRDLENVPLPVARQQTARGSAGGIMIRTTLGVP
DSVDIMFFDGQGADLSQGSQRKLDRVFARQEYRRAFPGEIGDLHFPSSVFDSYTGSLLRN
VDITGIAESGLKVVVDASNGSAGLVLPSLLGKLGVDSLTINPGLDEARPTESADMRRSGL
VRLGEIVASSRAAFGVRFDPVGERLSLVDEKGRIIEDDRALLVMLDLIAAERRSGRVALP
VTTTRIAEQVAAYHGTQVEWTTTSPDDLTRVGGEEGAIFGGDGKGGFIVPEFSSVYDGTA
AFVRLIGLVARTQLTLSQIDARIPRAHVLKRDLATPWAVKGLVMRRVVEAAGDRFVDTTD
GVRVVETDGRWVMVLPDPAEAVTHLWAEGPDDASAQALLDEWAAVVDSAGR
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtcgtgatggctggaggcgaaggcacacgccttcgtcccatgacctcgagc
atgcccaagccgctcctgccggtggtcaaccggccgatcatggagcatgttcttcggctg
ctcaaaaggcatgggctcaacgagaccgtcgtgaccgtccagttcctggcctcactggtc
aagaactacttcggtgacggcgaggagctcggaatggagctcacctatgccaacgaggag
aagccactcggtaccgccggaagcgtcaagaacgccgaggaggcattgaaggacgatgcc
ttcctcgtcatttccggcgatgccctgaccgacttcgacctcaccgatctgatcaacttc
cacaaggaaaagggctcgctcgtcaccgtgtgtctgacgcgcgtgcccaacccgctggaa
ttcggtatcaccatcgtcgacgaagagggcaaggtcgagcgcttcctggagaagccgacc
tggggccaggtcttctcggacaccgtgaacaccggcatctacgtcatggagcccgaggtc
ttcaactatgtcgaccccgatgtgcccgtggactggtccggtgacgtcttcccgcagttg
atgaaggaaggcaagcccatctacggctatgtcgccgagggctactgggaggacgtcggt
acccatgagagctatgtgaaggcccaggccgacgttctggaacgcaaggtcgacgtcgac
atcgacggcttcgagatctcgcccggcgtctgggtggccgagggtgcggaggtgcatccc
gacgcggtgctgcgcggacccctctacgtcggcgactacgcgaaggtcgaggccggcgcg
gagatccgcgaacacacggtgatcgggtccaacgtcgtcgtcaagagcggcgccttcctg
cacaaggccgtggtcgccgacaacgtgtacgtcggcccgcacagcaatctgcgcggctgt
gtggtcggcaagaacaccgacatcatgcgcgccgcgcggatcgaggacggcgcggtcatc
ggcgacgaatgcctggtcggtgaagaatcgatcatccagggcaatgtgcgggtctacccg
ttcaagaccatcgaggcaggcgcgttcgtcaacacctcggtgatctgggaatcccgcggg
caggcgcatctcttcggtgcgcgcggggtctccggcatcctcaacgtggagatcaccccg
gagctggccgtgcggctggccggtgcgtacgcgacgaccctgaagaaggggtccaccgtc
accacggcccgtgaccactcccgtggcgcccgggcgctgaagcgggcggtgatctccgcg
ctgcaggccagcgccatcgacgtacgcgacctggagaacgtacccctgcccgtggcgcgg
cagcagaccgcgcggggcagcgccggcgggatcatgatccggaccaccctcggggtgccg
gactccgtcgacatcatgttcttcgacggccagggcgccgacctctcgcagggcagccag
cgaaagctggaccgggtcttcgcgcgccaggagtaccggcgggcgttccccggcgagatc
ggggacctgcacttcccgtccagcgtgttcgactcctacaccgggtccctgctgcgcaac
gtcgacatcaccggcatcgcggagtccgggctcaaggtggtcgtcgacgcctccaacggc
agcgcgggactggtgctgccgagcctgctcgggaagctcggcgtcgactccctgacgatc
aatcccggtctcgacgaggccaggcccaccgagtcggccgacatgcggcggtccggtctg
gtgcgcctcggggagatcgtggcgtcctcgcgggccgcgttcggcgtgcggttcgacccc
gtcggtgaacggctgtcgctcgtcgacgagaagggccgcatcatcgaggacgaccgggcg
ctgctggtgatgctcgacctgatcgcggccgagcggcgcagcggccgggtggcgctcccg
gtgaccaccaccaggatcgccgagcaggtcgccgcgtaccacggcacgcaggtcgagtgg
acgaccacctccccggacgatctgacgcgggtggggggcgaggaaggcgcgatcttcggc
ggagacggcaagggcggcttcatcgtccccgagttcagcagtgtgtacgacggcacggcg
gccttcgtgcggctgatcggactggtcgcgcgcacgcagctcacgctgagccagatcgac
gcgcggatcccgcgggcccacgtcctcaagcgcgatctggccactccgtgggcggtcaag
ggcctggtgatgcggcgggtcgtcgaggcggccggagaccggttcgtggacaccacggac
ggggtgcgggtggtcgagaccgacgggcgctgggtgatggtcctgcccgaccccgcggag
gcggtcacccatctgtgggcggagggccccgacgacgcctccgcacaggcgctgctggac
gagtgggccgcggtggtggacagcgcgggccgctga

DBGET integrated database retrieval system