KEGG   Streptomyces coelicolor: SCO1389Help
Entry
SCO1389           CDS       T00085                                 

Gene name
SC1A8A.09c
Definition
(RefSeq) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K08744  
cardiolipin synthase (CMP-forming) [EC:2.7.8.41]
Organism
sco  Streptomyces coelicolor
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCO1389 (SC1A8A.09c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.41  cardiolipin synthase (CMP-forming)
     SCO1389 (SC1A8A.09c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1467874..1468521)
Genome map
AA seq 215 aa AA seqDB search
MSIIGSFPPGGPRVEVQETRVQTDRVLTIPNILSMARLAGVPLFLWLILRPEFGGPQSDG
WALLVLALSGVSDYLDGKLARRWNQISSLGRLLDPAADRLYILSTLVGLTWREILPLWLT
LVLLAREAMLLVMVGILRRHGYPPPQVNFLGKAATFNLMYAFPLLLLSDGSGWIASLAAV
FGWAFAGWGTTLYWWAGVLYVVQVRRLVRADVAAD
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcattggctcgtttcccccaggaggcccccgcgtggaggtccaggagacccgc
gtgcagaccgaccgggtcctcaccatcccgaacatcctcagcatggcgcgcctggccggc
gtgcctctgttcctgtggctcatcctgcggcccgagttcggcggcccgcagagcgacggc
tgggcgctgttggtgctggccctgagcggggtcagcgactacctggacggaaagctcgca
cggcgctggaatcagatcagcagccttggccggctcctggacccggcggccgaccgcctc
tatatcctctccacgctggtgggtctcacctggcgcgagattctcccgctctggttgacc
cttgtactgcttgccagggaagcgatgctgctggtgatggtgggcatcctccggcggcac
ggctatcctccgccgcaggtgaacttcctgggcaaggccgccaccttcaacctcatgtac
gccttccccctgcttctgctgagcgacggcagcggatggatcgcgtcactggccgcagtt
ttcggatgggcgttcgccggatggggtacaaccctgtattggtgggcaggtgttctctac
gtggtgcaggtccgccgcctggttcgtgcggacgtcgcagccgattga

DBGET integrated database retrieval system