KEGG   Streptomyces coelicolor: SCO1391Help
Entry
SCO1391           CDS       T00085                                 

Gene name
SC1A8A.11
Definition
(RefSeq) phosphoenolpyruvate-protein phosphotransferase
  KO
K08483  
phosphotransferase system, enzyme I, PtsI [EC:2.7.3.9]
Organism
sco  Streptomyces coelicolor
Pathway
Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:sco00001]
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    SCO1391 (SC1A8A.11)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     SCO1391 (SC1A8A.11)
Transporters [BR:sco02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    SCO1391 (SC1A8A.11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
1474827..1476497
Genome map
AA seq 556 aa AA seqDB search
METTLRGVGVSHGVAIGEVRHMGTAVLEPPAKQIPAEDAEREQGRARKAVEAVAADLMAR
GNLAGGEAQAVLEAQAMMAQDPELLADVERRITVGSTAERAVYDAFAAYRALLAGAGEYL
AGRVADLDDVRNRIVARLLGVPMPGVPDSDEPYVLIARDLAPADTALLDPTLVLGFVTEE
GGPTSHSAILARALGVPAVVALPGAGEIPEGTVVAVDGSTGEIFVNPAEEKKARLAAEAA
ERKAALAAATGPGATSDGHKVPLLANIGGPADVPAAVEAGAEGVGLFRTEFLFLDDSANA
PSEEKQITAYRQVLEAFPEGRVVVRVLDAGADKPLDFLTPGDEPNPALGVRGLRTLLDHP
DVLRTQLTALAKAAEGLPVYLEVMAPMVADRADAKAFADACREAGLRAKFGAMVEIPSAA
LRARSVLQEVEFLSLGTNDLAQYTFAADRQVGAVSRLQDPWQPALLDLVALSAEAAKAEG
KSCGVCGEAAADPLLACVLTGLGVTSLSMGAASLPYVRATLAKFTLAQCERAAAAARAAD
SAEEARTAAQAVLSGE
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggagacaacgctgcgaggcgtcggcgtgagccacggtgtggcgatcggcgaggttcgg
cacatggggacggcggttctggaaccgccggcgaagcagattccggccgaggacgcggag
cgtgagcaggggcgcgcccgcaaggcggtggaagctgtggcggccgatctgatggcgcgc
ggcaacctggccgggggcgaggcgcaggccgtgctcgaggcgcaggccatgatggcccag
gacccggaactgctggccgacgtcgagcggcggatcaccgtcgggagcacggccgagcgt
gccgtgtacgacgccttcgccgcctaccgggccctgctggccggtgccggtgagtacctg
gccggccgcgtggcggacctcgacgacgtgcggaatcgtatcgtcgcccgtctgctcggg
gtcccgatgccgggcgttccggacagcgacgagccgtacgtcctcatcgcccgggatctg
gcgcctgccgacaccgcgctgctcgacccgacgctcgtcctgggcttcgtcaccgaggag
ggcgggccgaccagccacagcgcgattctcgcgcgggcgctcggcgtgcccgccgtcgtg
gccctgccgggcgccggtgagattcccgagggcaccgttgtggcggtggacggtagcacc
ggtgagatcttcgtgaatcccgctgaggagaagaaggcacggctggcggccgaggccgcc
gagcgcaaggccgcgctggccgcagcgacgggtcccggcgcgacctcggacggtcacaag
gtgccgctgctggcgaacatcggtggtcccgccgacgtgcccgcggcggtcgaggccggc
gccgagggtgtcggcctgttccggaccgagttcctcttcctcgacgacagcgcgaacgct
ccgtcggaggagaagcagatcaccgcctaccgccaggtgctggaggcgttcccggagggc
cgggtcgtcgtgcgggtgctggacgccggcgccgacaagccgctggacttcctcaccccg
ggcgacgagccgaaccccgcgctcggcgtgcgcggcctgcggacgctgctcgaccacccg
gacgtgctgcggacgcagctgacggcgctggcgaaggcggcggaggggctgccggtctat
ctcgaggtcatggcaccgatggtggcggaccgggcggatgccaaggcgttcgcggacgcc
tgccgcgaggccgggctgcgggcgaagttcggcgcgatggtggagatcccgtcggccgcg
ctgcgggcgcgctcggtgctgcaggaggtggagttcctgtcgctggggacgaacgacctc
gcgcagtacaccttcgccgccgaccgtcaggtgggcgcggtgtcgcggctgcaggacccg
tggcagccggctctgctcgacctggtcgcgctgtcggccgaggcggcgaaggccgagggc
aagagctgcggtgtctgcggcgaggccgctgcggatccgctgctggcgtgtgtgctgacc
ggtcttggtgtcacctctctgtccatgggtgcggcgtcgctgccgtacgtgcgggcgacg
ctggcgaagttcacgctggcgcagtgcgagcgtgccgcggccgccgcccgggcggcggac
agtgccgaggaggcgcgcaccgccgcgcaggcggtgctgtccggcgagtag

DBGET integrated database retrieval system