KEGG   Streptomyces coelicolor: SCO1439Help
Entry
SCO1439           CDS       T00085                                 

Gene name
hisE
Definition
(RefSeq) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  
phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
sco  Streptomyces coelicolor
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO1439 (hisE)
  Amino acid metabolism
   00340 Histidine metabolism
    SCO1439 (hisE)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     SCO1439 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1535782..1536054)
Genome map
AA seq 90 aa AA seqDB search
MSKKTFEELFTELQHKAANGDPATSRTAELVDKGVHAIGKKVVEEAAEVWMAAEYEGKDA
AAEEISQLLYHVQVMMVARGISLDDVYAHL
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaagactttcgaggagctgttcaccgagctccagcacaaggcagccaacggc
gaccccgccacctcccgcaccgccgaactggtggacaagggggtccatgccatcggcaag
aaggtcgtcgaggaagccgccgaggtctggatggccgccgagtacgagggcaaggacgcg
gcggccgaggagatctcccagctgctgtaccacgtccaggtgatgatggtcgcccgcggc
atctccctggacgacgtctacgcccacctgtaa

DBGET integrated database retrieval system