KEGG   Streptomyces coelicolor: SCO1441Help
Entry
SCO1441           CDS       T00085                                 

Gene name
ribAB, SC6D7A.04c
Definition
(RefSeq) bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein
  KO
K14652  
3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
sco  Streptomyces coelicolor
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SCO1441 (ribAB)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SCO1441 (ribAB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     SCO1441 (ribAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(1536596..1537885)
Genome map
AA seq 429 aa AA seqDB search
MSTAPILYSPDGPEDLVLDPVEQAVADIAAGRPVVVVDDENRENEGDLVIAAEKATEEIV
AFMMTECRGLICAPMEGEELDRLRLPQMVDDNTESMKTAFTVSVDAGAAHGVTTGISAAD
RATTLRLLAGGTAEPGDLVRPGHVFPLRARPGGVLVRNGHTEAAVDLARLAGLRPAGAIV
EIAGEDGRMLRLPELIPFARKHGLTIISIEDLIAYRRSAEPTVRREAEVRLPTKHGEFTA
YGYRSTVDGVEHIALVHGEIGDGEDVLVRVHSECLTGDVFGSQRCDCGPQLDASLDRIQA
EGRGVVVYLRGHEGRGIGLMSKLRAYELQERGRDTLDANLELGLPADARDYGAGAQILAD
LGVRAVRLLTNNPDKSDALERHGITVTGREPMPVQAGEHNLRYLRTKRDRMGHDLPWLDT
TPVSTCGNQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggcacccatcctctacagccccgacggccccgaggacctcgtcctcgacccc
gtcgagcaggccgtcgcggacatcgccgcgggccgccccgtcgtggtcgtcgacgacgag
aaccgcgagaacgagggcgacctcgtcatcgccgccgagaaggcgaccgaggagatcgtc
gccttcatgatgaccgagtgccgcggcctgatctgcgcccccatggagggcgaggaactg
gaccggctccggctcccgcagatggtcgacgacaacaccgagtcgatgaagaccgccttc
accgtctccgtggacgccggtgccgcccacggcgtcaccaccggcatctccgccgccgac
cgcgccaccaccctccggctcctggcgggcggcaccgccgagcccggcgacctggtccgc
cccgggcacgtcttcccgctgcgcgcccgccccggcggcgtactcgtccgcaacggccac
accgaggccgccgtcgacctggcccgcctcgcgggactgcgcccggccggcgccatcgtg
gagatcgccggtgaggacgggcgcatgctgcggctgcccgagctgatcccgttcgcccgc
aagcacggcctgacgatcatctccatcgaggacctcatcgcctaccggcgcagcgcggaa
cccaccgtccgccgcgaggccgaggtacggctgcccacgaagcacggcgagttcacggcg
tacggctaccgctccaccgtcgacggcgtcgagcacatcgccctcgtgcacggcgagatc
ggcgacggcgaggacgtcctggtccgcgtccactccgagtgcctcaccggcgacgtcttc
ggctcccagcgctgcgactgcggcccccagctcgacgcctccctggaccgcatccaggcc
gagggccggggagtcgtcgtctacctgcgcggccacgaggggcgcggcatcggcctgatg
tccaagctgcgcgcctacgaactccaggagcgcggccgggacaccctcgacgccaacctg
gaactcggcctgcccgccgacgcccgcgactacggcgcaggcgcgcagatcctcgccgac
ctcggcgtgcgagccgtccgcctcctgaccaacaacccggacaagagcgacgccctcgaa
cggcacggcatcacggtcaccggccgcgagcccatgcccgtccaggccggcgagcacaac
ctccgctacctgcgcaccaagcgggaccggatgggacacgacctgccctggctggacacg
acccccgtgtccacctgcggcaaccagtaa

DBGET integrated database retrieval system