KEGG   Streptomyces coelicolor: SCO1443Help
Entry
SCO1443           CDS       T00085                                 

Gene name
SC6D7A.06c
Definition
(RefSeq) riboflavin synthase subunit alpha
  KO
K00793  
riboflavin synthase [EC:2.5.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SCO1443 (SC6D7A.06c)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.9  riboflavin synthase
     SCO1443 (SC6D7A.06c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1538523..1539125)
Genome map
AA seq 200 aa AA seqDB search
MFTGIVEELGEITAVETLDDACRFRVRGPAVTEGARHGDSIAVNGVCLTVVDHEGDAFTA
DVMAETLNRSSLGALAVGSRVNLERPTAVGARLGGHIVQGHVDGTGEILERKPSEHWEIV
KISLPADLARYVVEKGSITVDGISLTVVDAGPDFFTVSLIPTTLALTTLGIKQPGDPVNL
EVDVIAKYVERLLGAQGSTK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaccggaatcgtcgaagagctgggcgagatcaccgcagtcgagaccctcgacgac
gcctgtcgcttccgcgtgcgcggccccgcggtcaccgaaggtgcccggcacggcgactcg
atcgccgtcaacggcgtctgcctcacggtcgtcgaccacgagggcgacgcgttcacggcc
gacgtgatggccgagaccctgaaccgctccagcctcggcgccctcgccgtcggctcccgc
gtcaacctggagcgccccaccgccgtcggcgcccggctcggcgggcacatcgtgcagggc
cacgtcgacggcaccggcgagatcctggagcgcaagccctccgagcactgggagatcgtc
aagatctcgctgcccgccgacctcgcccgctacgtcgtggagaagggctccatcaccgtc
gacggcatcagcctcaccgtcgtcgacgcgggacccgacttcttcaccgtcagcctcatc
cccaccacgctcgccctgaccacgctgggcatcaaacagcccggcgacccggtcaacctc
gaggtcgacgtcatcgccaagtacgtcgagcggctgctcggcgcccaggggagtaccaag
tga

DBGET integrated database retrieval system