KEGG   Streptomyces coelicolor: SCO1464Help
Entry
SCO1464           CDS       T00085                                 

Gene name
rpe, SCL6.21c
Definition
(RefSeq) ribulose-phosphate 3-epimerase
  KO
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO1464 (rpe)
   01230 Biosynthesis of amino acids
    SCO1464 (rpe)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO1464 (rpe)
   00040 Pentose and glucuronate interconversions
    SCO1464 (rpe)
Enzymes [BR:sco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     SCO1464 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1561471..1562157)
Genome map
AA seq 228 aa AA seqDB search
MAAQINPSILSADFARLADEAKAVEGADWLHVDVMDNHFVPNLTLGVPVVESLARATDTP
LDCHLMIEAPDRWAPQYVEAGAGSVTFHAEAAAAPVRLAREIRAKGARASMALKPATPVE
PYEDLLPELDMLLIMTVEPGFGGQAFLDIMLPKIRRTRELIKKHGLELWLQVDGGVSAAT
IERCADAGADVFVAGSAVYGASDPAEAVRALRTQADAATAEASWSCDH
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcagatcaaccccagcatcctgtccgccgacttcgcccgcctcgcggacgag
gccaaggcggtcgagggagccgactggctccacgtcgacgtcatggacaaccacttcgtc
ccgaacctcacgctcggtgtgccggtggtcgagtccctggcccgcgcgaccgacaccccg
ctcgactgccacctgatgatcgaggcccccgaccgctgggcgccgcagtacgtggaggcg
ggcgccggttccgtcaccttccacgccgaggcggccgccgcgccggtgcggctggcccgg
gagatccgggccaagggcgcccgcgcgtccatggcgctcaagcccgcgacgccggtcgag
ccctacgaggacctgctccccgaactcgacatgctgctgatcatgacggttgaacccggc
ttcggtgggcaggcgttcctggacatcatgcttcccaagatccgccgcacccgtgagctg
atcaagaagcacggtctggagctgtggctccaggtcgacggcggtgtctcagcggccacg
atcgagcggtgcgccgacgccggagccgacgtcttcgtcgcggggtccgcggtgtacggg
gcgtccgacccggccgaggcggtacgtgcactgcgcacgcaggcagacgcggcgaccgcc
gaggcatcctggtcctgcgaccactga

DBGET integrated database retrieval system