KEGG   Streptomyces coelicolor: SCO1476Help
Entry
SCO1476           CDS       T00085                                 

Gene name
metK, SCL6.33c
Definition
(RefSeq) S-adenosylmethionine synthetase
  KO
K00789  
S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
sco  Streptomyces coelicolor
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Methionine degradation
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO1476 (metK)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO1476 (metK)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     SCO1476 (metK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1577727..1578935)
Genome map
AA seq 402 aa AA seqDB search
MSRRLFTSESVTEGHPDKIADQISDTILDALLREDPTSRVAVETLITTGLVHVAGEVTTK
AYADIANLVRGKILEIGYDSSKKGFDGASCGVSVSIGAQSPDIAQGVDTAYENRVEGDED
ELDRQGAGDQGLMFGYASDETPTLMPLPVFLAHRLSKRLSEVRKNGTIPYLRPDGKTQVT
IEYDGDKAVRLDTVVVSSQHASDIDLESLLAPDIKEFVVEPELKALLEDGIKIDTENYRL
LVNPTGRFEIGGPMGDAGLTGRKIIIDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVA
KNVVAAGLAARCEVQVAYAIGKAEPVGLFVETFGTAKVDTEKIEKAIDEVFDLRPAAIIR
ALDLLRPIYAQTAAYGHFGRELPDFTWERTDRVDALREAAGL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgtcgcctgttcacctcggagtccgtgaccgaaggtcaccccgacaagatcgct
gaccagatcagcgacacgattctcgacgcgcttctgcgcgaggacccgacctcccgggtc
gccgtcgaaaccctgatcaccaccggtctggtgcacgtggccggcgaggtcaccaccaag
gcctacgcggacatcgccaacctggtccgcggcaagatcctggagatcggctacgactcc
tccaagaagggcttcgacggcgcctcctgcggcgtctcggtctccatcggcgcgcagtcc
ccggacatcgcgcagggcgtcgacacggcgtacgagaaccgggtggagggcgacgaggac
gagctggaccgccagggtgccggcgaccagggcctgatgttcggctacgcgtccgacgag
acgccgacgctgatgccgctgccggtcttcctggcgcaccgcctgtccaagcgcctgtcc
gaggtccgcaagaacggcaccatcccgtacctgcgtccggacggcaagacccaggtcacc
atcgagtacgacggcgacaaggccgtccgtctggacacggtcgtcgtctcctcccagcac
gcgagcgacatcgacctggagtcgctgctggcgccggacatcaaggagttcgtcgtcgag
ccggagctgaaggcgctcctcgaggacggcatcaagatcgacacggagaactaccgcctc
ctggtcaacccgaccggccgcttcgagatcggcggcccgatgggcgacgccggtctgacc
ggccgcaagatcatcatcgacacctacggcggcatggcccggcacggcggcggcgccttc
tccggcaaggacccgtcgaaggtcgaccgctccgcggcgtacgcgatgcgctgggtcgcc
aagaacgtcgtggccgcgggtctcgccgcgcgctgcgaggtccaggtcgcctacgccatc
ggcaaggccgagcccgtgggtctgttcgtggagaccttcggtaccgccaaggtcgacacc
gagaagatcgagaaggcgatcgacgaggtcttcgacctgcgcccggccgccatcatccgc
gctctcgacctgctccgcccgatctacgcccagaccgcggcgtacggtcacttcggccgt
gagctgcccgacttcacgtgggagcgcaccgaccgcgtggacgcgctgcgcgaggccgcg
ggcctgtaa

DBGET integrated database retrieval system