KEGG   Streptomyces coelicolor: SCO1482Help
Entry
SCO1482           CDS       T00085                                 

Gene name
pyrD, SC9C5.06c
Definition
(RefSeq) dihydroorotate dehydrogenase 2
  KO
K00254  
dihydroorotate dehydrogenase [EC:1.3.5.2]
Organism
sco  Streptomyces coelicolor
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO1482 (pyrD)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.2  dihydroorotate dehydrogenase (quinone)
     SCO1482 (pyrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1582901..1584007)
Genome map
AA seq 368 aa AA seqDB search
MYKTFFKLVFSRMDPERAHHLAFRWIRLAVRVPVLRTFVAAALAPRHKELRTEALGLRMH
GPFGLAAGFDKNAVAIDGMAMLGFDHVEIGTVTGEPQPGNPKKRLFRLVADRALINRMGF
NNDGSLAVAARLASRTPVFRTVVGVNIGKTKVVPEEEAVGDYVKSAERLAPHADYLVVNV
SSPNTPGLRNLQATEALRPLLSAVREAADRAVTARRVPLLVKIAPDLADEDVDAVADLAV
ELGLDGIIATNTTIAREGLGLTSSPALVGETGGLSGAPLKARSLEVLRRLYARVGDRITL
VGVGGVETAEDAWERILAGATLVQGYSAFIYEGPFWGRAMHKGLAARLRQSPYATLADAV
GADVRKHS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagaccttcttcaagctcgtcttctcccgcatggacccggagcgggcccaccac
ctcgccttccgctggatccgcctcgccgtccgcgtccccgtcctgcgcaccttcgtcgcc
gccgcgctcgcgccccgccacaaggaactgcgcaccgaggccctcggcctgcgcatgcac
ggccccttcggcctcgccgccgggttcgacaagaacgcggtcgccatcgacggcatggcg
atgctcggcttcgaccacgtcgagatcggcaccgtgacgggggagccgcagcccggcaac
cccaagaagcggctgttccgcctggtggccgaccgtgcgctgatcaaccgcatgggcttc
aacaacgacggctcgctggccgtcgcggcccgcctggcctcccgcacgcccgtcttccgc
accgtcgtcggcgtcaacatcggcaagacgaaggtcgtccccgaggaggaggccgtcggc
gactacgtgaagtccgccgagcggctggccccgcacgccgactacctggtcgtcaacgtc
tcctcgcccaacacgcccggcctgcgcaacctccaggccaccgaggcgctgcgcccgctg
ctgagcgcggtccgcgaggccgccgaccgcgcggtgaccgcccggcgtgtcccgctgctg
gtcaagatcgcgccggacctcgccgacgaggacgtggacgcggtcgccgacctggccgtg
gagctgggcctggacggcatcatcgccaccaacaccaccatcgcgcgcgagggactcggc
ctgacctcctcgcccgccctcgtcggggagaccggcggtctgtccggggccccgctcaag
gcacgctccctggaggtgctgcgccgcctctacgcgcgcgtgggcgaccggatcaccctg
gtcggtgtcggcggggtcgagacggccgaggacgcctgggagcgcatcctggccggtgcc
accctggtccagggctacagcgcgttcatctacgaaggccccttctggggccgcgccatg
cacaagggactcgccgcccgcctgcggcagagcccgtacgccaccctcgccgacgcggtc
ggcgccgacgtaaggaagcactcatga

DBGET integrated database retrieval system