KEGG   Streptomyces coelicolor: SCO1486Help
Entry
SCO1486           CDS       T00085                                 

Gene name
pyrC
Definition
(RefSeq) dihydroorotase
  KO
K01465  
dihydroorotase [EC:3.5.2.3]
Organism
sco  Streptomyces coelicolor
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO1486 (pyrC)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     SCO1486 (pyrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1589116..1590402)
Genome map
AA seq 428 aa AA seqDB search
MSKTLIRGAKVLGGEPQDVLIDGTVVEAVGTNLSAEGAEVVEADGKVLLPGLVDLHTHLR
EPGREDSETVLTGTRAAASGGYTNVFAMANTFPVADTAGVVEQVWRLGQESGYCDVQPIG
AVTVGLEGAKLAELGAMHESAAGVTVFSDDGKCVHDAVIMRRALEYVKAFNGVVAQHAQE
PRLTEGAQMNEGVVSAELGLGGWPAVAEESVIARDVLLAEHVGSRVHICHLSTAGSVEIV
RWAKSRGIDVTAEVTPHHLLLTDELVRSYNPVYKVNPPLRTERDVMALREALADGTIDIV
ATDHAPHPHEDKDCEWAAAAMGMVGLETALSVVQETMVDTGLLDWAGVADRMSFKPAKIG
QATGHGRPVSAGEPANLTLVDAAYRGQVDPAGFASRSRNTPYEGRELPGRVTHTWLRGKA
TLVDGKLT
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccctgatccgcggtgcgaaggtgctcggcggcgagccgcaggacgtgctg
atcgacgggaccgtcgtcgaggcggtcggcacgaacctgtccgccgagggcgcggaggtc
gtcgaggccgacggcaaggtgctgctgccgggcctggtggacctgcacacccacctgcgc
gagcccggccgcgaggactccgagaccgtcctcaccggcacccgcgcggccgcgagcggc
ggctacaccaacgtcttcgccatggccaacaccttcccggtcgccgacaccgccggcgtc
gtcgagcaggtctggcggctcggccaggagtccggctactgcgacgtgcagcccatcggc
gccgtcaccgtcggcctggagggcgccaagctcgccgagctgggcgccatgcacgagtcc
gcggccggtgtcaccgtcttctccgacgacggcaagtgcgtccacgacgccgtgatcatg
cgccgcgccctggagtacgtgaaggccttcaacggcgtcgtcgcccagcacgcccaggag
ccccggctcaccgagggcgcccagatgaacgagggcgtcgtctccgccgagctgggcctc
ggcggctggcccgccgtcgccgaggagtcggtcatcgcccgggacgtgctgctcgccgag
cacgtcggctcccgcgtgcacatctgccacctgtcgaccgccgggtccgtcgagatcgtc
cgctgggccaagtcccgcggcatcgacgtcaccgccgaggtcaccccgcaccacctgctc
ctcaccgacgagctggtccggtcgtacaacccggtctacaaggtcaacccgccgctgcgc
accgagcgcgacgtcatggcgctgcgcgaggcgctcgccgacggcacgatcgacatcgtc
gccaccgaccacgccccgcacccgcacgaggacaaggactgcgagtgggccgccgccgcc
atggggatggtgggcctggagaccgcgctgtccgtggtgcaggagaccatggtggacacg
ggcctgctggactgggccggcgtcgccgaccggatgtccttcaagcccgccaagatcgga
caggccaccggacacggccgtcccgtctcggccggtgagcccgccaacctcaccctggtc
gatgcggcataccgtggccaggtggaccccgcgggcttcgcctcgcgcagtcgcaacacc
ccctacgaggggcgtgagctgccgggccgtgtgacgcacacgtggctgcggggcaaggcc
acgctcgtcgacgggaagctcacgtga

DBGET integrated database retrieval system