KEGG   Streptomyces coelicolor: SCO1488Help
Entry
SCO1488           CDS       T00085                                 

Gene name
pyrR, SC9C5.12c
Definition
(RefSeq) bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase
  KO
K02825  
pyrimidine operon attenuation protein / uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
sco  Streptomyces coelicolor
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO1488 (pyrR)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     SCO1488 (pyrR)
Transcription factors [BR:sco03000]
 Prokaryotic Type
  Other transcription factors
   Others
    SCO1488 (pyrR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1591502..1592083)
Genome map
AA seq 193 aa AA seqDB search
MDKQQDQQQEARPVLEGPDIARVLTRIAHEIVERAKGADDVVLLGIPTRGVFLARRLADK
LEQITERKMPVGSLDITMYRDDLRMHPPRALARTEIPGDGIDGRLVVLVDDVLFSGRTIR
AALDALNDIGRPRAVQLAVLVDRGHRELPIRADYVGKNLPTSLRETVKVQLAEEDGRDTV
LLGAKPAAPGAHP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggacaagcaacaggaccagcagcaggaagcccggcccgttctcgaagggcccgacatc
gcgcgggtgctgacccgcatcgcccacgagatcgtcgaacgcgccaagggcgccgacgac
gtggtgctcctcggcatcccgacccggggcgtcttcctcgcccggcggctcgccgacaag
ctggagcagatcaccgaacgcaagatgccggtcggctcgctggacatcaccatgtaccgc
gacgacctgcgcatgcatccgccgcgcgccctggcccgcaccgagatccccggtgacggc
atcgacggccgcctcgtcgtcctcgtcgacgacgtgctcttctccggccgcaccatccgc
gccgccctcgacgcgctgaacgacatcggccgcccgcgcgcggtgcagctcgccgtactc
gtcgaccgcggccaccgcgaactgcccatccgcgccgactacgtcggcaagaacctcccg
acgtcgctgcgggagacggtcaaggtccagctcgccgaggaggacggtcgcgacaccgtg
ctgctcggtgccaagccggccgccccgggcgcccacccctag

DBGET integrated database retrieval system