KEGG   Streptomyces coelicolor: SCO1494Help
Entry
SCO1494           CDS       T00085                                 

Gene name
aroB
Definition
(RefSeq) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO1494 (aroB)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     SCO1494 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-GeneID: 1096920
NCBI-ProteinID: NP_625774
Kitasato: SCO1494
UniProt: Q9KXQ6
Position
complement(1596490..1597581)
Genome map
AA seq 363 aa AA seqDB search
MSEAVTRIQVGGTAGSEPYEVLVGRQLLGELGGLIGAKAKRVAVIHPEALAETGDALRAD
LAAQGYEAIAIQVPNAEEAKTAEVAAYCWKALGQSGFTRTDVIVGVGGGASTDLAGFVAA
TWLRGVRWIAVPTTVLSMVDAAVGGKTGINTAEGKNLVGSFHPPAGVLCDLAALDSLPVN
DYVSGLAEVIKAGFIADPAILDLIEADPQAARTPAGPHTAELIVRSIKVKAEVVSSDLKE
AGLREILNYGHTLGHAIEKNERYKWRHGAAVSVGMHFAAELGRLAGRLDDATADRHRSIL
EAVGLPLHYRYDQWPKLVENMKVDKKSRGDLLRFIVLDGLAKPTVLEGPDPAVLLAAYGE
VGE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcagtcacccggatccaggtcggcggcaccgcggggtccgagccctacgag
gtcctggtgggccgtcagctcctgggcgagctgggcggtctgatcggggcgaaggcgaag
cgggtcgcggtgatccaccccgaggcgctcgccgagaccggtgacgcgctgcgcgccgac
ctcgccgctcagggctacgaggcgatcgcgatccaggtgcccaacgccgaggaggccaag
accgccgaggtcgccgcgtactgctggaaggcgctgggccagtccgggttcacccgtacc
gacgtcatcgtcggggtcggcggcggcgccagcaccgacctggccgggttcgtggccgcg
acctggctgcgcggggtgcgctggatcgccgtccccaccaccgtgctgtccatggtggac
gcggccgtcggcggcaagaccggcatcaacaccgccgagggcaagaacctcgtcggctcc
ttccacccgccggccggtgtcctgtgcgacctcgccgccctggactccctcccggtcaac
gactacgtctccggcctcgccgaggtcatcaaggccggcttcatcgcagacccggcgatc
ctcgacctgatcgaggccgacccgcaggccgcgcggacgccggccggtccgcacaccgcc
gagctgatcgtgcgctccatcaaggtcaaggccgaggtcgtctcgtccgacctgaaggaa
gcgggcctgagggagatcctgaactacggccacaccctcggccacgccatcgagaagaac
gagcgctacaagtggcgccacggcgccgccgtatcggtcggcatgcacttcgccgccgaa
ctcggccgcctcgcgggccgcctggacgacgccaccgccgaccgccaccgctccatcctc
gaagcggtcggcctcccgctgcactaccgctacgaccagtggcccaagctcgtcgagaac
atgaaggtcgacaagaagtcgcgcggcgacctgctgcgcttcatcgtcctggacggcctc
gccaagcccaccgttctggagggccccgacccggccgtcctcctcgccgcctacggcgag
gtgggcgagtag

DBGET integrated database retrieval system