KEGG   Streptomyces coelicolor: SCO1513Help
Entry
SCO1513           CDS       T00085                                 

Gene name
relA, SCL2.03c
Definition
(RefSeq) GTP pyrophosphokinase
  KO
K00951  
GTP pyrophosphokinase [EC:2.7.6.5]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO1513 (relA)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     SCO1513 (relA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(1616607..1619150)
Genome map
AA seq 847 aa AA seqDB search
MPDEAQPLTAAKPESASASAAKPAPSAPQAKNDTHGPIQHAPAAPVDKPAEQQPRPKPLP
AERPQNAPVVRAPAGQPARSGSSNRVRARLARLGVQRANPYNPVLEPLLRIVRGNDPKIE
TSTLRQIERAYQVAERWHRGQKRKSGDPYITHPLAVTTILAELGMDPATLMAGLLHDTVE
DTEYGLEDLRRDFGDVVTLLVDGVTKLDKVKFGEAAQAETVRKMVVAMAKDPRVLVIKLA
DRLHNMRTMRYLKREKQEKKARETLEIYAPLAHRLGMNTIKWELEDLAFAILYPKMYDEI
VRLVAERAPKRDEYLAVVTDEVQQDLRAARIKATVTGRPKHYYSVYQKMIVRGRDFAEIY
DLVGIRVLVDTVRDCYAALGTVHARWNPVPGRFKDYIAMPKFNMYQSLHTTVIGPGGKPV
ELQIRTFDMHRRAEYGIAAHWKYKQEAVAGASKVRTDAPKSSGKSKDDHLNDMAWLRQLL
DWQKETEDPGEFLESLRFDLSRNEVFVFTPKGDVIALPAGATPVDFAYAVHTEVGHRTIG
ARVNGRLVPLESTLDNGDLVEVFTSKAAGAGPSRDWLGFVKSPRARNKIRAWFSKERRDE
AIEQGKDAIVRAMRKQNLPIQRILTGDSLVTLAHEMRYSDISALYAAIGEGHVSAPNIVQ
KLVQALGGEEAATEEIDESVPPSRGRGRKRRANADPGVVVKGVEDVWVKLARCCTPVPGD
PIIGFVTRGSGVSVHRSDCVNVDSLSREPERILEVEWAPTQSSVFLVAIQVEALDRSRLL
SDVTRVLSDQHVNILSAAVQTSRDRVATSRFTFEMGDPKHLGHVLKAVRGVEGVYDVYRV
TSARRPS
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
ttgccagacgaggcccagccactgaccgccgcaaagcccgagtccgcctcggcgtccgcg
gcgaagcccgcgccgagcgcgccccaggcgaagaacgacacgcacgggccgatccagcac
gccccggccgcaccggtcgacaagccggccgagcagcagccgcgccccaagccgctgccg
gccgagcgcccgcagaacgcgcccgtggtccgcgcccccgccgggcagcccgcccgctcc
ggctcctccaaccgcgtccgcgcccgcctggcccgcctcggcgtgcagcgcgccaacccg
tacaacccggtcctggagccgctgctgcgcatagtgcgcggcaacgacccgaagatcgag
acgtcgaccctgcgccagatcgagcgggcctaccaggtcgccgaacgctggcaccgcggc
cagaagcgcaagagcggcgacccgtacatcacgcacccgctcgccgtcaccaccatcctc
gccgagctgggcatggatccggccacgctgatggccgggctgctgcacgacaccgtcgag
gacaccgagtacggcctggaggacctgcgccgcgacttcggcgacgtggtcaccctgctc
gtcgacggcgtcaccaagctggacaaggtcaagttcggcgaggccgcgcaggccgagacc
gtgcgcaagatggtcgtcgccatggccaaggacccgcgcgtcctggtcatcaagctcgcc
gaccgcctgcacaacatgcgcaccatgcgctacctcaagcgcgagaagcaggagaagaag
gcgcgcgagaccctggagatctacgcgccgctcgcccatcgcctgggcatgaacaccatc
aagtgggagctggaggacctcgccttcgcgatcctctaccccaagatgtacgacgagatc
gtccgcctggtcgccgagcgagcccccaagcgcgacgagtacctcgccgtcgtcaccgac
gaggtccagcaggacctgcgcgcggcccgcatcaaggcgaccgtcaccggccgccccaag
cactactacagcgtctaccagaagatgatcgtccgcggccgggacttcgcggagatctac
gacctggtgggcatccgcgtcctggtggacaccgtccgcgactgctacgcggcgctcggc
acggtccacgcccgctggaacccggttccggggcggttcaaggactacatcgcgatgccc
aagttcaacatgtaccagtcgctgcacacgacggtcatcgggcccggcggcaagccggtc
gagctgcagatccgcaccttcgacatgcaccgccgcgcggagtacggcatcgccgcgcac
tggaagtacaagcaggaggccgtcgccggcgcctccaaggtgcgcaccgacgcccccaag
tcgtccggcaagagcaaggacgaccacctcaacgacatggcgtggctgcgccagctgctc
gactggcagaaggagaccgaggaccccggggagttcctggagtccctgcgcttcgacctc
tcccgcaacgaggtcttcgtcttcacccccaagggcgacgtcatagcgcttccggccggg
gccaccccggtggacttcgcctacgccgtccacaccgaggtcggccaccgcaccataggg
gcacgggtcaacggacggctggtgccgctggagtccaccctggacaacggcgacctggtg
gaggtcttcacctccaaggcggccggcgcgggcccctcccgcgactggctgggcttcgtg
aagtcgccgcgcgcccgcaacaagatccgcgcctggttctccaaggagcgccgcgacgag
gcgatcgagcagggcaaggacgccatcgtccgcgcgatgcgcaagcagaacctgccgatc
cagcgcatcctcaccggcgactccctggtgacgctcgcgcacgagatgcggtactcggac
atctccgcgctgtacgcggcgatcggcgagggccacgtctccgcgccgaacatcgtgcag
aagctggtccaggcgctcggcggcgaggaggccgccaccgaggagatcgacgagtcggtc
ccgccgtcccgcggccgcggccgcaagcgccgggccaacgccgacccgggcgtggtcgtc
aagggcgtcgaggacgtgtgggtcaagctggcccgctgctgcacgcccgtgcccggcgac
ccgatcatcggcttcgtcacccgcggcagcggcgtctccgtccaccgcagcgactgcgtg
aacgtggactcgctctcccgcgagccggagcgcatcctcgaggtcgagtgggcgcccacc
cagtcctcggtcttcctggtcgccatccaggtcgaggcgctggaccgctcccggctgctg
tcggacgtcacgcgtgtgctgtccgaccagcacgtcaacatcctgtcggcggccgtccag
acctcccgcgaccgggtggccacctcccgcttcaccttcgagatgggcgacccgaagcac
ctggggcacgtcctgaaggccgtacgcggcgtcgagggcgtctacgacgtgtaccgggtg
acttcggcgcgcaggccgtcgtag

DBGET integrated database retrieval system