KEGG   Streptomyces coelicolor: SCO1514Help
Entry
SCO1514           CDS       T00085                                 

Gene name
apt, SCL2.06c
Definition
(RefSeq) adenine phosphoribosyltransferase
  KO
K00759  
adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO1514 (apt)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     SCO1514 (apt)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO1514 (apt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1619334..1619831)
Genome map
AA seq 165 aa AA seqDB search
MADYPEPGVVFKDITPLLADPGAFAALTDALAEAAGRTGATKVVGLEARGFILGAPVALR
AGLGFIPVRKAGKLPGATLSQAYDLEYGSAEIEVHAEDLTAGDRVLVVDDVLATGGTAEA
SLELIRRAGAEVAGLAVLMELGFLGGRARLEPALAGAPLEALLTV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtggccgactacccggagccgggcgtggtgttcaaggacatcaccccgctcctggcggac
ccgggggcgttcgccgccctgaccgacgcgctcgccgaggccgccgggcgcaccggcgcc
accaaggtcgtcggcctggaggcccgcggcttcatcctcggcgccccggtggccctgagg
gcgggtctcggcttcatccccgtgcgcaaggcgggcaagctccccggagccacgctcagc
caggcgtacgacctggagtacggctccgccgagatcgaggtgcacgccgaggacctcacc
gcgggcgaccgcgtgctggtcgtcgacgacgtcctcgccaccggcggcaccgccgaggcc
tcgctggagctgatccgccgggccggtgccgaggtcgcgggcctcgccgtgctgatggag
ctgggcttcctcggcgggcgggcccggctggagccggcgctggccggggcaccgctggag
gcactgctcacggtctga

DBGET integrated database retrieval system