KEGG   Streptomyces coelicolor: SCO1546Help
Entry
SCO1546           CDS       T00085                                 

Gene name
SCL11.02c
Definition
(RefSeq) aminotransferase
  KO
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
sco  Streptomyces coelicolor
Pathway
Cysteine and methionine metabolism
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO1546 (SCL11.02c)
   01230 Biosynthesis of amino acids
    SCO1546 (SCL11.02c)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO1546 (SCL11.02c)
   00280 Valine, leucine and isoleucine degradation
    SCO1546 (SCL11.02c)
   00290 Valine, leucine and isoleucine biosynthesis
    SCO1546 (SCL11.02c)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO1546 (SCL11.02c)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     SCO1546 (SCL11.02c)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class IV
   SCO1546 (SCL11.02c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1654295..1655116)
Genome map
AA seq 273 aa AA seqDB search
MKIWLDGGLQDIGSARVSVLDHGLTVGDGIFETVKAVDGRPFALTRHLDRLTRSARGLGL
PAPDHDEVRRACAAVLEANPMPLGRLRVTYTGGHGPLGSDRGEHGPTLVVALGETGRRPD
STAVITVPWTRNERGALTGLKTTSYAENVVALARARERGATEALFGNTVGRLCEGTGSNV
FVVLDGEIHTPPVASGCLAGITRALAAEWTGARETDLPLDVLGRADEVFLTSTLRDVQAV
HRIDDRELPGAPGPVTAKAMRIFQERSGDDLDP
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatctggctcgacggcgggttgcaggacatcggttccgcccgcgtctccgtcctc
gatcacggactgaccgtgggcgacggcatcttcgagaccgtgaaggcggtggacggccgg
ccgttcgcgttgacccggcacctggaccggctgacccgctcggcccgcggcctcggcctg
cccgcccccgaccacgacgaggtccgccgcgcctgtgccgccgtgctggaggccaacccg
atgccgctgggccggctgcgcgtcacctacaccggcggccacggcccgctcggctccgac
cgcggcgagcacggcccgaccctcgtcgtcgccctcggcgagaccggccgccgccccgac
tccaccgccgtgatcacggtgccctggacccgcaacgaacgcggcgcgctcaccggcctg
aagaccacctcctacgccgagaacgtcgtcgccctggcccgggcccgcgaacggggcgcc
accgaggcgctgttcggcaacacggtgggccggctctgcgagggcaccgggtcgaacgtc
ttcgtcgtcctcgacggcgagatccacaccccgccggtcgcctccggctgcctcgccggg
atcacccgcgccctggccgccgagtggaccggtgcccgcgagaccgacctcccgctggac
gtcctggggcgcgccgacgaggtcttcctgacctcgacgctgcgggacgtacaggccgtg
caccggatcgacgaccgcgaactgccgggcgccccgggaccggtgacggccaaggccatg
cggatcttccaggagcggtccggggacgacctggatccgtga

DBGET integrated database retrieval system