KEGG   Streptomyces coelicolor: SCO1570Help
Entry
SCO1570           CDS       T00085                                 

Gene name
argH, SCL24.06c
Definition
(RefSeq) argininosuccinate lyase
  KO
K01755  
argininosuccinate lyase [EC:4.3.2.1]
Organism
sco  Streptomyces coelicolor
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO1570 (argH)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO1570 (argH)
   00220 Arginine biosynthesis
    SCO1570 (argH)
Enzymes [BR:sco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     SCO1570 (argH)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO1570 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(1680432..1681859)
Genome map
AA seq 475 aa AA seqDB search
MSSNSGDVRLWGGRFADGPAEALAKLSASVHFDWRLAPYDIAGSRAHARVLHAAGLLTED
ELTRMIAGLDRLEADVADGSFTGTIADEDVHTALERGLLERLGPDLGGKLRAGRSRNDQV
ATLFRMYLRDHARTVGSLIADLQDALVGLAEAHPDVAMPGRTHLQHAQPVLFAHHVLAHA
QALGRDAERLRQWDARTAVSPYGSGALAGSSLGLDPEAVARDLGFEHGSVGNSIDGTASR
DFVAEFAFITAMIGVNVSRIAEEIIIWNTKEFSFVTLHDAFSTGSSIMPQKKNPDIAELA
RGKSGRLIGNLTGLMATLKALPLAYNRDLQEDKEPVFDSIDQLEVLLPAFTGMMATLTVH
RERMEELAPAGFSLATDIAEWLVKQGVPFRVAHEVAGECVKVAEADGKELDELTDEQFAK
ISEHLTPEVRTVLNVPGALASRDGRGGTAPSAVAVQLAEVKADVAAQHAWADAKK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcaacagcggtgacgtccggctctggggcggccgtttcgccgacggtcccgcc
gaggccctggcgaagctgtccgcgtccgtccacttcgactggcggctcgcgccctacgac
atcgccggttcgcgcgcccacgcgcgcgtgctgcacgcggcggggctgctcaccgaggac
gagctgacccggatgatcgccggactggaccggctggaggcggacgtcgccgacggctcc
ttcaccggcaccatcgccgacgaggacgtccacacggccctggagcgcgggctgctggag
cgcctcggccccgacctcggcggcaagctgcgcgccgggcgctcccgcaacgaccaggtg
gcgaccctcttccggatgtacctgcgcgaccacgcccggaccgtcggctcgctgatcgcc
gacctccaggacgcactggtcggcctcgccgaggcccacccggacgtggccatgcccggc
cgcacccacctccagcacgcccagccggtgctcttcgcccaccacgtgctcgcccacgcc
caggcgctgggccgggacgcggagcggctgcgccagtgggacgcgcgcaccgccgtctcc
ccgtacggctcgggcgcgctcgcgggcagcagcctcggcctggacccggaggccgtcgcc
cgtgacctgggcttcgagcacggcagcgtcggcaactccatcgacgggacggcctcgcgc
gacttcgtcgccgagttcgccttcatcaccgcgatgatcggcgtcaacgtctcccggatc
gccgaggagatcatcatctggaacacgaaggagttctccttcgtcaccctccacgacgcc
ttctccaccggctcctcgatcatgccgcagaagaagaaccccgacatcgccgagctggcc
cgcggcaagtccgggaggctgatcggcaacctgaccggcctgatggcgaccctcaaggcg
ctcccgctcgcgtacaaccgcgacctccaggaggacaaggagccggtcttcgactccatc
gaccagctggaggtcctgctccccgccttcaccggcatgatggccaccctcaccgtgcac
cgcgagcggatggaggagctggccccggccgggttctcgctcgccaccgacatcgccgag
tggctggtcaagcagggtgtgccgttccgcgtcgcgcacgaggtggccggcgagtgcgtc
aaggtcgccgaggccgacggcaaggagctggacgagctgaccgacgagcagttcgccaag
atctccgagcacctcacccccgaggtgcgcaccgtcctcaacgtccccggcgccctggcc
tcccgcgacggccgcggcggcacggcgcccagcgcggtcgccgtccagctcgccgaggtc
aaggcggacgtggcggcccagcacgcctgggcggacgccaagaagtag

DBGET integrated database retrieval system