KEGG   Streptomyces coelicolor: SCO1578Help
Entry
SCO1578           CDS       T00085                                 

Gene name
argB, SCL24.14c
Definition
(RefSeq) acetylglutamate kinase
  KO
K00930  
acetylglutamate kinase [EC:2.7.2.8]
Organism
sco  Streptomyces coelicolor
Pathway
Arginine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO1578 (argB)
   01230 Biosynthesis of amino acids
    SCO1578 (argB)
  Amino acid metabolism
   00220 Arginine biosynthesis
    SCO1578 (argB)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.8  acetylglutamate kinase
     SCO1578 (argB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1688368..1689288)
Genome map
AA seq 306 aa AA seqDB search
MSDGTSNAPTRKHTALPKAQILIEALPWLTRHHGKTVVIKFGGNAMIDEDLKAAFAQDVV
FLRHAGLKPVVVHGGGPQISAALDKHGIVSEFKAGLRVTTEDAMDVVRMVLAGQVQRELV
GLLNQHGPLAVGLTGEDAHTLTATKHQPEIDGELVDIGRVGEITEIDTGAIEALLADGRI
PVVSSIARSQDDHHVYNVNADTAAAALAAALGAETLMVLTDVEGLYEDWPDSDEVISRLT
ASELEKLLPDLSSGMVPKMEGCLHAVRGGVTTARVIDGRVQHSILLEIFTDEGIGTMVVP
DEQGES
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacggaacgagcaacgcacccacgcggaagcacaccgcgctccccaaggcccag
atcctcatcgaggcgctgccctggctgacccggcaccacggcaagaccgtcgtcatcaag
ttcggcggcaacgccatgatcgacgaagacctcaaggccgccttcgcccaggacgtcgtc
ttcctgcggcacgccggcctcaagcccgtggtcgtgcacggcggcggcccgcagatcagc
gccgcgctcgacaagcacggcatcgtcagcgagttcaaggccgggctgcgcgtcaccacc
gaggacgccatggacgtcgtacggatggtgctggccgggcaggtgcagcgcgaactggtc
gggctgctcaaccagcacgggccgctcgccgtcggcctcaccggcgaggacgcgcacacc
ctcaccgccaccaagcaccagcccgagatcgacggtgaactcgtcgacatcgggcgggtc
ggcgagatcaccgagatcgacaccggcgccatcgaggcactgctcgccgacggccgcatc
ccggtcgtctcctcgatcgcccgttcccaggacgaccaccatgtctacaacgtcaatgct
gatacggcggctgcggcactcgctgctgcgctcggcgccgagactctcatggtcctcacc
gacgtggagggcctctacgaggactggccggactccgacgaggtgatcagccgcctcacc
gcgtccgagctggagaaactgctgcccgacctgtccagcggcatggtgccgaagatggag
ggctgcctgcacgccgtgcggggcggcgtcaccaccgcccgggtcatcgacggccgggtc
cagcactcgatcctgctggagatcttcaccgacgaggggatcggcacgatggtcgtgccg
gacgaacagggggagtcgtga

DBGET integrated database retrieval system