KEGG   Streptomyces coelicolor: SCO1579Help
Entry
SCO1579           CDS       T00085                                 

Gene name
argJ
Definition
(RefSeq) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase
  KO
K00620  
glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
Arginine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO1579 (argJ)
   01230 Biosynthesis of amino acids
    SCO1579 (argJ)
  Amino acid metabolism
   00220 Arginine biosynthesis
    SCO1579 (argJ)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     SCO1579 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     SCO1579 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1689285..1690436)
Genome map
AA seq 383 aa AA seqDB search
MSVTAAKGFTAAGITAGIKESGSPDLALVVNTGPRRSAAGVFTSNRVKAAPVLWSEQVLK
SGEVTAVVLNSGGANACTGPKGFQDTHATAEKAADVLGTGAGEVAVCSTGLIGVLLPMDK
LLPGVEAAAGQLSEHGGEKAAIAIKTTDTVHKTSVVTRDGWTVGGMAKGAGMLAPGLATM
LVVITTDADLETEALDRALRAATRVTFDRVDSDGCMSTNDTVLLLSSGSSGVTPEYDAFA
EAVRTVCDDLGQQLIRDAEGASKDIKVEVVNAATEDEAVQVGRTIARNNLLKCAIHGEDP
NWGRVLSAIGTTDAAFEPDRLNVAINGVWVCKNGGVGEDRELVDMRYREVHIVADLAAGD
ATATIWTNDLTADYVHENSAYSS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgacggcagcgaagggattcacggcggcgggcatcaccgccgggatcaaggag
agcggcagccccgacctggccctcgtggtcaacaccggcccccgccgctccgccgcgggc
gtcttcacctccaaccgcgtcaaggccgcgcccgtcctgtggtccgagcaggtcctcaag
agcggtgaggtgaccgccgtggtgctcaactccggcggcgccaacgcctgcaccgggccc
aagggcttccaggacacgcacgccacggccgagaaggccgccgacgtgctcgggacgggg
gcgggagaggtcgccgtctgctccaccgggctcatcggcgtgctgctccccatggacaag
ctgctcccgggtgtggaggcggccgccggtcagctctccgagcacggcggcgagaaggcc
gccatcgccatcaagaccacggacaccgtgcacaagacgtccgtcgtgacgcgggacggc
tggaccgtcggcggcatggccaagggcgcgggcatgctcgcccccggcctcgccaccatg
ctcgtcgtgatcaccaccgacgccgacctggagaccgaggccctggaccgcgccctgcgc
gccgccacccgcgtcaccttcgaccgggtcgactccgatggctgcatgtccaccaacgac
accgtgctgctgctctcctccggctcctccggcgtcaccccggagtacgacgccttcgcc
gaggccgtccgcaccgtctgcgacgacctcggacagcagctcatccgggacgccgagggc
gccagcaaggacatcaaggtcgaggtcgtcaacgccgcgaccgaggacgaggccgtccag
gtgggccgcaccatcgcccgcaacaacctgctcaagtgcgccatccacggcgaggacccc
aactggggccgcgtgctctccgccatcggcaccaccgacgcggccttcgagcccgaccgg
ctgaacgtcgccatcaacggcgtctgggtctgcaagaacggcggcgtgggcgaggaccgc
gagctggtcgacatgcgctaccgcgaggtgcacatcgtcgccgacctcgccgcgggcgac
gccaccgccaccatctggaccaacgacctcaccgcggactacgtccacgagaacagcgcg
tactcctcatga

DBGET integrated database retrieval system