KEGG   Streptomyces coelicolor: SCO1612Help
Entry
SCO1612           CDS       T00085                                 

Gene name
SCI35.34c
Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00146  
phenylacetaldehyde dehydrogenase [EC:1.2.1.39]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine metabolism
Styrene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    SCO1612 (SCI35.34c)
  Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    SCO1612 (SCI35.34c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.39  phenylacetaldehyde dehydrogenase
     SCO1612 (SCI35.34c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1723278..1724729)
Genome map
AA seq 483 aa AA seqDB search
MRHRLSELSELSDLSEPSERLPDELRVLNPATEEVVATVPAASAADVDAAVARAARAQTA
WAALAPGDRARLLRRFAVTVDEHLEELARLEVRQAGHLLGNARWEAGNVRDLLDYAAGGV
ERLTGRQIPVAGGLDVTLLEPLGVVGVIAPWNFPMPIAAWATAPALAAGNAVLLKPAETT
PLTALRLAELALVAGLPEDLFQVLPGHGPVAGDALVEHPDVAKIVFTGSTAVGRQVAAKG
AALLKPVTLELGGKSPNIVFADADVEAAAAATPMSFLDNSGQDCCARTRILVQRSVHDRF
LELLAPAIEAVRVGDPADESTEMGPLISRAQLERVRSHVPADAAGIRGRAPRGGPGFWFP
PTVLTGVDAHARVAVEEVFGPVAVVLPFDDEADAVRLANATDYGLAGSLWTRDVGRALRV
SGAVRAGNLSVNSHASVRYWTPFGGFKQSGIGRELGPDALTAFTETKNVFFSTTPSSTEG
PAQ
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcaccggttgtccgagctgtccgagctgtctgacctctccgagccgtccgagagg
ctccccgacgagctacgtgtcctgaaccccgccaccgaagaggtcgtcgccaccgtcccc
gccgcctccgcggccgacgtggacgccgccgtcgcccgcgccgcacgggcgcagaccgcc
tgggccgccctcgcccccggcgaccgggcccggctgctgcgccgcttcgccgtcaccgtc
gacgagcacctggaggagctggcccgtctggaggtccgccaggccgggcacctcctcggc
aacgcccgctgggaggccggcaacgtccgcgacctgctcgactacgccgccgggggagtc
gagcggctcaccggacgccagatcccggtggccggcggcctggacgtcacgctcctcgaa
ccactcggcgtcgtgggcgtcatcgccccctggaacttcccgatgccgatcgcggcctgg
gccacggcacccgcgctcgcggcgggcaacgcggtcctcctcaagcccgccgagacgacc
ccgctcaccgcgctccgcctggccgaactcgccctggtcgcaggccttcccgaggacctg
ttccaggtgctgcccgggcacgggccggtcgcgggcgacgcgctcgtcgaacacccggac
gtcgccaagatcgtcttcaccgggtccaccgccgtgggccggcaggtggccgccaagggc
gccgccctcctcaaaccggtcaccctcgaactcggcggcaagagccccaacatcgtcttc
gccgacgcggacgtcgaggccgccgcggccgcgacgcccatgtccttcctcgacaacagc
ggccaggactgctgcgcccgcacccgcatcctcgtccagcggtccgtgcacgaccgcttc
ctcgaactcctcgcccccgcgatcgaggccgtccgggtcggcgatccggccgacgagagc
accgagatgggcccgctgatctcccgcgcccaactggagcgcgtccgctcccacgtcccc
gcggacgccgccggcatccgcggcagggcgccccggggcggccccgggttctggttcccg
ccgaccgtcctcaccggcgtcgacgcgcacgcgcgcgtggccgtcgaggaggtcttcggg
cccgtcgccgtcgtcctgcccttcgacgacgaggccgacgcggtccgcctggccaacgcc
accgactacgggctggccggctccctgtggacccgggacgtcggccgcgccctgcgcgtg
tcgggcgcggtgcgcgccgggaacctgtccgtcaactcccacgccagtgtccgctactgg
acacccttcggcgggttcaagcagtccggcatcggccgcgagctgggcccggacgcgctg
accgcgttcaccgagaccaagaacgtcttcttcagcaccaccccatcgagcacggagggc
cccgcacagtga

DBGET integrated database retrieval system