KEGG   Streptomyces coelicolor: SCO1657Help
Entry
SCO1657           CDS       T00085                                 

Gene name
SCI46.02c
Definition
(RefSeq) methionine synthase
  KO
K00548  
5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
sco  Streptomyces coelicolor
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO1657 (SCI46.02c)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO1657 (SCI46.02c)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO1657 (SCI46.02c)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SCO1657 (SCI46.02c)
Enzymes [BR:sco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     SCO1657 (SCI46.02c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1772821..1776333)
Genome map
AA seq 1170 aa AA seqDB search
MASSPSTPPADTRTRVSALREALATRVVVADGAMGTMLQAQNPTLDDFQQLEGCNEVLNL
TRPDIVRSVHEEYFAAGVDCVETNTFGANHSALGEYDIPERVHELSEAGARVAREVADEF
GARDGRQRWVLGSMGPGTKLPTLGHAPYTVLRDAYQRNAEGLVAGGADALLVETTQDLLQ
TKASVLGARRALDVLGLDLPLIVSVTVETTGTMLLGSEIGAALTALEPLGIDMIGLNCAT
GPAEMSEHLRYLARHSRIPLTCMPNAGLPVLGKDGAHYPLTAPELADAHETFVREYGLSL
VGGCCGTTPEHLRQVVERVRDTAPTARDPRPEPGAASLYQTVPFRQDTSYLAIGERTNAN
GSKKFREAMLDGRWDDCVEMARDQIREGAHMLDLCVDYVGRDGVADMEELAGRFATASTL
PIVLDSTEVDVIRAGLEKLGGRAVINSVNYEDGAGPESRFARVTKLAREHGAALIALTID
EVGQARTAEKKVEIAERLIDDLTGNWGIHESDILVDCLTFTICTGQEESRKDGLATIEGI
RELKRRHPDVQTTLGLSNISFGLNPAARILLNSVFLDECVKAGLDSAIVHASKILPIARF
DEEQVTTALDLIYDRRREGYDPLQKLMQLFEGATAKSLKASKAEELAALPLEERLKRRII
DGEKNGLEQDLDEALRERPALEIVNDTLLDGMKVVGELFGSGQMQLPFVLQSAEVMKTAV
AHLEPHMEKTDDDGKGTIVLATVRGDVHDIGKNLVDIILSNNGYNVVNLGIKQPVSAILE
AADEHRADVIGMSGLLVKSTVIMKENLEELNQRKLAADYPVILGGAALTRAYVEQDLHEI
YDGEVRYARDAFEGLRLMDALIGIKRGVPGAKLPELKQRRVRAATVEIDERPEEGHVRSD
VATDNPVPTPPFRGTRVVKGIQLKEYASWLDEGALFKGQWGLKQARTGEGPSYEELVESE
GRPRLRGLLDRLQTDNLLEAAVVYGYFPCVSKDDDLIVLDDDGNERTRFTFPRQRRGRRL
CLADFFRPEESGETDVVGFQVVTVGSRIGEETARMFEANAYRDYLELHGLSVQLAEALAE
YWHARVRSELGFAGEDPAEMEDMFALKYRGARFSLGYGACPDLEDRAKIAALLEPERIGV
HLSEEFQLHPEQSTDAIVIHHPEAKYFNAR
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgtcgccatccaccccgcccgccgacacccgcacccgcgtgtccgccctccga
gaggccctcgccacccgcgtggtggtcgccgacggcgccatgggcaccatgctccaggcc
cagaaccccacgctggacgacttccagcagctcgaagggtgcaacgaggtcctgaacctc
acccggcccgacatcgtccgctcggtgcacgaggagtacttcgcggccggcgtcgactgc
gtcgagaccaacaccttcggcgccaaccactccgccctgggcgagtacgacatccccgag
cgcgtccacgaactgtccgaggccggcgcccgcgtcgcccgcgaggtcgccgacgagttc
ggcgcccgcgacggccggcagcgctgggtgctgggctccatgggccccggcaccaagctc
cccaccctcggccacgccccgtacaccgtcctgcgcgacgcctaccagcgcaacgccgag
ggactggtcgcgggcggcgcggacgcactgctggtggagaccacgcaggacctgctccag
accaaggcctcggtgctcggcgcccggcgcgccctggacgtcctcggcctcgacctgccg
ctcatcgtgtccgtcaccgtcgagaccaccggcaccatgctgctcggctcggagatcggc
gccgcgctcaccgcgctggaaccgctcggcatcgacatgatcggcctgaactgcgccacc
ggccccgccgagatgagcgagcacctgcgctacctcgcccggcactcccgcatcccgctg
acctgcatgcccaacgccggtctgcccgtcctcggcaaggacggcgcccactacccgctg
accgcgcccgagctggccgacgcacacgagaccttcgtgcgcgagtacggcctgtccctg
gtcggcggctgctgcggcaccacgcccgagcacctgcgccaggtcgtcgagcgggtccgg
gacaccgcccccaccgcacgcgacccgcgccccgagcccggcgccgcctcgctctaccag
accgtgcccttccgccaggacacctcctacctggccatcggcgagcgcaccaacgccaac
gggtccaagaagttccgcgaggccatgctggacggccgctgggacgactgcgtcgagatg
gcccgcgaccagatccgcgaaggcgcgcacatgctcgacctctgcgtcgactacgtcggc
cgggacggcgtcgccgacatggaggaactggccggccggttcgccaccgcctccacgctg
ccgatcgtcctcgactccaccgaggtcgacgtcatccgggccggcctggagaagctcggc
ggccgcgcggtgatcaactcggtcaactacgaggacggcgccggccccgagtcccggttc
gcccgcgtcacgaagctcgcccgggagcacggcgccgcgctgatcgcgctgaccatcgac
gaggtgggacaggcccgcaccgccgagaagaaggtcgagatcgccgaacggctcatcgac
gacctcaccggcaactggggcatccacgagtccgacatcctcgtcgactgcctgaccttc
accatctgcaccggccaggaggagtcccgcaaggacggcctggccaccatcgagggcatc
cgggaactcaagcggcgccacccggacgtgcagaccacgctcggcctgtcgaacatctcc
ttcggcctcaacccggccgcccgcatcctgctcaactccgtcttcctcgacgaatgcgtc
aaggccggcctggactcggccatcgtgcacgcgagcaagatcctgccgatcgcccgcttc
gacgaggagcaggtcaccaccgccctcgacttgatctacgaccgccgccgcgagggctac
gaccccctgcaaaagctcatgcagctcttcgagggcgccaccgccaagtcgctgaaggcc
tccaaggccgaggaactggccgccctcccgctggaggagcgcctcaagcgccgcatcatc
gacggcgagaagaacggcctcgaacaggacctcgacgaggccctccgggagcgcccggcc
ctcgagatcgtcaacgacaccctgctcgacggtatgaaggtcgtcggcgagctgttcggc
tccggccagatgcagctgccgttcgtgctccagtccgccgaggtcatgaagaccgcggtg
gcccacctggagccgcacatggagaagaccgacgacgacggcaagggcacgatcgtgctg
gccaccgtccgcggcgacgtccacgacatcggcaagaacctcgtcgacatcatcctgtcc
aacaacggctacaacgtcgtcaacctcggcatcaagcagcccgtctccgcgatcctggaa
gcggccgacgagcaccgggccgacgtcatcggcatgtccggcctcctcgtcaagtccacg
gtgatcatgaaggagaacctggaggagctgaaccagcgcaagctggccgccgactacccg
gtcatcctcggcggcgccgccctcaccagggcctacgtcgaacaggacctgcacgagatc
tacgacggcgaggtccgctacgcccgcgacgccttcgagggcctgcgcctcatggacgcc
ctcatcggcatcaagcgcggcgtgcccggcgccaagctgccggagctgaagcagcgccgg
gtgcgggccgccaccgtcgagatcgacgagcgccccgaggaaggccacgtccgctccgac
gtcgccaccgacaacccggtcccgaccccgcccttccgcggcacccgcgtcgtcaagggc
atccagctcaaggagtacgcctcctggctcgacgagggcgccctcttcaagggccagtgg
ggcctcaagcaggcccgcaccggcgagggaccctcctacgaggaactggtcgagtccgag
ggccggccgcggctgcgcggcctgctcgaccggctccagacggacaaccttttggaggcg
gccgtggtctacggctacttcccctgcgtctccaaggacgacgacctgatcgtcctcgac
gacgacggcaacgaacgcacccgcttcaccttcccccgccagcgccgcggccggcgcctg
tgcctggccgacttcttccgcccggaggagtccggcgagaccgacgtggtcggcttccag
gtcgtcaccgtcggctcccgcatcggcgaggagacggcccgcatgttcgaggccaacgcc
taccgcgactatctcgagctgcacggcctgtccgtgcagctcgccgaggccctcgccgag
tactggcacgcgcgcgtgcgctcggaactcggcttcgccggggaggacccggccgagatg
gaggacatgttcgccctgaagtaccggggtgcccgcttctccctcggctacggcgcctgc
cccgacctggaggaccgcgccaagatcgccgccctgctggagcccgagcgcatcggcgtc
cacctatccgaggagttccagctccaccccgagcagtccaccgacgccatcgtcatccac
cacccggaggccaagtacttcaacgcccgctga

DBGET integrated database retrieval system