KEGG   Streptomyces coelicolor: SCO1679Help
Entry
SCO1679           CDS       T00085                                 

Gene name
SCI52.21
Definition
(RefSeq) gluconokinase
  KO
K00851  
gluconokinase [EC:2.7.1.12]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO1679 (SCI52.21)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO1679 (SCI52.21)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.12  gluconokinase
     SCO1679 (SCI52.21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
1798561..1799088
Genome map
AA seq 175 aa AA seqDB search
MQQLHTPHVVVVMGVAGTGKTTIGPLLAARLGVPYAEGDDFHPPANIAKMTAGTPLTDED
RWPWLDAIGGWAHGRAGLGGVVSSSALKRSYRDRLRAAAPGVVFVHLTGSRELIEDRMSH
RQGHFMPTALLDSQFATLQPLQPDEAGVAVDVAGTPEEITERAVDALKGLPGPVQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaactgcacaccccccacgtggtcgtggtcatgggcgtcgcgggcaccgggaag
accaccatcggtcccctgctcgcggcccggctcggcgttccctacgccgagggcgacgac
ttccaccctccggccaacatcgccaagatgacggccggcaccccgctcaccgacgaggac
cgctggccctggctggacgccatcggcggctgggcgcacgggcgtgccgggctcggtggg
gtggtgagcagttcggcgctgaagcggtcgtaccgcgaccggctgcgggccgccgctccc
ggtgtcgtcttcgtgcatctcacgggcagccgtgagctgatcgaggaccggatgtcgcac
cggcagggccacttcatgccgacggccctgctcgactcccagttcgccacgctccagccg
ctgcagccggacgaggcgggagtcgcggtggacgtcgccggcacccccgaggagatcacc
gaacgggcggtcgacgccctgaagggccttcccgggccggtccagtaa

DBGET integrated database retrieval system