KEGG   Streptomyces coelicolor: SCO1680Help
Entry
SCO1680           CDS       T00085                                 

Gene name
SCI30A.01, SCI52.22
Definition
(RefSeq) gluconate permease
  KO
K03299  
gluconate:H+ symporter, GntP family
Organism
sco  Streptomyces coelicolor
Brite
Transporters [BR:sco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SCO1680 (SCI30A.01)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
1799183..1800580
Genome map
AA seq 465 aa AA seqDB search
MTRLSVEMLAADPVEPITSAGHAQLGIAVLLGIAVIVLLITKFKLHAFLSLTIGSLALGA
FAGAPLDKVITSFTAGLGSTVAGVGVLIALGAILGKMLADSGGADQIVDTILAKATPRSM
PWTMVLIASVIGLPLFFEVGIVLLIPVVLMVAKRGNYSLMRIGIPALAGLSVMHGLVPPH
PGPLVAIDAVDANLGVTLALGVLIAIPTVIIAGPVFSKYAARWVDVPAPDRMIPQRASER
LDKRPSFGATLATILLPVVLMLLKALVDIIIDDPDNVVQRTFDVIGNPLIALLVSVIVGI
FTLLRPAGFGKDRLSGLVEKGLAPIAGILLIVGAGGGFKQTLIDSGVGQMVLDISKDWSI
PALLLAWLIAVVIRLATGSATVATVSAAGLVAPLAADMSTTHAALLVLAIGAGSLFFSHV
NDAGFWLVKEYFGLNVGQTIKTWSVMETIISVVAGALVLLLSLVI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagactcagcgtcgagatgctggcagcggaccccgtcgagccgatcacctcggcg
ggccacgcccagctgggcatcgccgtgctcctgggcatcgccgtcatcgtcctgctcatc
accaagttcaagctgcatgccttcctgtcgctgaccatcgggtcgctggcgctcggcgcg
ttcgccggtgcgccgctggacaaggtcatcaccagcttcaccgccggactcggctccacc
gtcgcgggcgtcggcgtcctgatcgccctcggtgcgatcctcggcaagatgctcgccgac
tccggcggcgccgaccagatcgtggacaccatcctggcgaaggccacgccccgttcgatg
ccgtggacgatggtgctgatcgcctcggtcatcggactgccgctgttcttcgaggtcggc
atcgtgctgctgatcccggtcgtcctgatggtcgccaagcgcggcaactactcgctgatg
cggatcggcatcccggcgctggccggtctgtccgtgatgcacggcctggtcccgccgcac
cccggcccgctggtcgccatcgacgcggtggacgccaacctcggtgtgaccctggcgctg
ggcgtgctgatcgcgatccccaccgtgatcatcgccggtccggtcttctcgaagtacgcg
gcccgctgggtggacgtcccggcccccgaccgcatgatcccgcagcgcgcctccgagcgg
ctggacaagcgtccgagcttcggcgccacgctggccacgatcctgctgccggtcgtgctg
atgctgctcaaggccctggtcgacatcatcatcgacgaccccgacaacgtggtgcagcgc
accttcgacgtcatcggcaacccgctgatcgccctgctggtctcggtgatcgtcggcatc
ttcacgctgctgcggcccgccgggttcggcaaggaccgtctctccggcctggtcgagaag
gggctggcgcccatcgccggcatcctcctgatcgtcggcgcgggcggcggcttcaagcag
acgctgatcgactcgggcgtgggccagatggtcctggacatctccaaggactggtcgatc
ccggcgctgctgctcgcctggctgatcgcggtggtgatccggctggcgaccggttcggcg
acggtggcgaccgtctcggcggccggtctggtcgcgccgctggcggccgacatgtcgacc
acgcacgccgccctgctggtcctggccatcggcgccggttcgctcttcttcagtcacgtc
aacgacgccggcttctggctggtgaaggagtacttcgggctgaacgtggggcagaccatc
aagacctggtccgtcatggagacgatcatctcggtggtcgccggtgccctggtcctgctg
ttgtccctggtcatatag

DBGET integrated database retrieval system