KEGG   Streptomyces coelicolor: SCO1690Help
Entry
SCO1690           CDS       T00085                                 

Gene name
SCI30A.11
Definition
(RefSeq) acyl-CoA dehydrogenase
  KO
K00249  
acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO1690 (SCI30A.11)
   01212 Fatty acid metabolism
    SCO1690 (SCI30A.11)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCO1690 (SCI30A.11)
  Lipid metabolism
   00071 Fatty acid degradation
    SCO1690 (SCI30A.11)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO1690 (SCI30A.11)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO1690 (SCI30A.11)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     SCO1690 (SCI30A.11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
1809406..1810620
Genome map
AA seq 404 aa AA seqDB search
MDFAYDAHTEELRARLLAFMDEYVYPAEQVAHEQRARLASPWDTPQVVEDLKAEARRQGL
WNLFLPDAEHGAGLTNLQYAPLAEITGRSPQLAPTATNCAAPDTGNMEVLAQFADEAQRK
QWLEPLLAGEIRSAFAMTEPEVASSDATNITTHIERDGDEYVVTGRKWYISGAMNPDCKI
FIVMGKTDPDGEDIRRQQSMVLVRRDTPGVTVDRAMQVFGYEDHYHGGHAEVTFDHARVP
VSNLIGEEGGGFAIAQARLGPGRIHHCMRLIGMAERAIELMCRRAVSREAFGKALAQQGV
VHNWIADARVTVEQLRLLVLKTAWLMDTVGNRGAHTEIQAIKIATPRAVVGIIDRAIQLH
GAGGVSQDFPLAELYAGARTLMIADGPDEVHQRSLARRELKKYR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgcgtacgacgcacacaccgaggaactccgcgcccggctgctcgccttcatg
gacgagtacgtctacccggccgagcaggtcgcccacgagcagcgcgcccgcctcgcctcc
ccctgggacaccccgcaggtcgtggaggacctcaaggccgaggcccgccgccagggcctg
tggaacctgttcctgcccgacgccgagcacggcgccggcctcaccaacctccagtacgcc
ccgctcgccgagatcaccggccgcagcccgcagctggcgccgacggcgacgaactgcgcg
gcgccggacaccgggaacatggaggtgctggcccagttcgccgacgaggcgcagcggaag
cagtggctggagcccctgctcgccggggagatccggtccgcgttcgcgatgacggagccg
gaggtggcctcctccgacgccacgaacatcaccacgcacatcgaacgcgacggcgacgag
tacgtcgtcacgggccgcaagtggtacatctccggggcgatgaacccggactgcaagatc
ttcatcgtgatgggcaagacggaccccgacggcgaggacatccgccgccagcagtcgatg
gtgctggtccggcgcgacacgcccggggtgacggtcgaccgggccatgcaggtgttcggc
tacgaggaccactaccacggcggccacgccgaggtgaccttcgaccacgcgcgcgtgccg
gtgtcgaacctgatcggcgaggagggcggcgggttcgccatcgcccaggcccggctcggt
cccggccggatccaccactgcatgcggctgatcggcatggccgagcgggcgatcgagctg
atgtgccgccgcgcggtgtcccgcgaagccttcggcaaggcgctggcccagcagggcgtg
gtccacaactggatcgcggacgcccgggtcaccgtcgagcagctgcggctgctggtgctg
aagacggcctggctgatggacacggtcggcaaccggggcgcgcacaccgagatccaggcc
atcaagatcgccacgccccgcgccgtggtcggcatcatcgaccgggcgatccagctgcac
ggcgcgggcggcgtgagtcaggacttcccgctggccgagctgtacgcgggcgcccggacg
ctgatgatcgccgacggtcccgacgaggtgcaccagcgctcgctggcccgcagggagctc
aagaagtaccggtga

DBGET integrated database retrieval system