KEGG   Streptomyces coelicolor: SCO1715Help
Entry
SCO1715           CDS       T00085                                 

Gene name
hgd, SCI11.04
Definition
(RefSeq) homogentisate 1,2-dioxygenase
  KO
K00451  
homogentisate 1,2-dioxygenase [EC:1.13.11.5]
Organism
sco  Streptomyces coelicolor
Pathway
Tyrosine metabolism
Styrene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCO1715 (hgd)
  Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    SCO1715 (hgd)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.5  homogentisate 1,2-dioxygenase
     SCO1715 (hgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
1835784..1837109
Genome map
AA seq 441 aa AA seqDB search
MSGDARKTAEGLAYLSGFGNEHASEAVAGALPEGRNSPQRAPLGLYAEQLSGTAFTEPRA
HNRRSWLYRIRPSAAHPAFTRSGNGTIRTAPFNQAVPDPNRLRWNPLPVPGPATDFVEGL
WTLGGNGDATQRTGMAVHLYHATASMDRVFSDADGELLIVPERGGLLLRTEFGLLHAEPG
HVALIPRGVRFRVQLLDEDARGYVCENYGAPFQLPDLGPIGANGLANARDFRAPVAAYED
DESTPGPVEVVNKFCGNLWTAEYDHSPLDVVAWHGNHVPYVYDLRRFNVIGSISYDHPDP
SIFTVLTSPSDTPGLAGVDFVVFAPRWLVGEDTFRPPYFHRNVMSEYMGLIEGAYDAKAE
GFVPGGGSLHNMMSAHGPDRETFDRASAAELKPQRIDDGLAFMFETRWPVTLTPQAARAE
HLQPGYDDVWQGLERHFRPLH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggacgcgcggaagaccgcggaggggctggcctatctgtccggtttcggcaac
gagcacgcctcggaggccgtggcgggcgcgctgcccgagggccggaactcgccgcagcgg
gcgccgttgggcctgtacgcggagcagctgagcggcacggcgttcacggagccgagggcg
cacaaccggcggtcgtggctgtaccggatccgcccgtcggccgcacaccccgcgttcacc
cgttcgggcaacggcacgatccgcaccgcgcccttcaaccaggccgtgccggacccgaac
cggctgcgctggaacccgctgccggtgcccgggcccgccacggacttcgtcgaggggctg
tggacgctcggcggcaacggcgacgcgacgcagcgcaccggcatggccgtgcacctgtac
cacgccaccgcgtccatggaccgcgtcttcagcgacgcggacggcgagctgctgatcgtc
ccggagcgcggcggcctgctgctgcgcaccgagttcgggctgctgcacgccgagccggga
cacgtggcgctgatcccgcgcggggtccgcttccgcgtccagctgctggacgaggacgcc
cgcggctacgtctgcgagaactacggcgcgccgttccagctccccgacctgggcccgatc
ggcgccaacggcctggccaacgcccgggacttccgcgcgccggtcgccgcgtacgaggac
gacgagagcacgccgggcccggtggaggtggtcaacaagttctgcggcaacctctggacg
gccgagtacgaccactccccgctggacgtcgtcgcctggcacggcaaccacgtgccctac
gtctacgacctgcgccgcttcaacgtcatcggctccatctcgtacgaccacccggacccg
tcgatcttcacggtgctcacctccccgtcggacacgccgggactggcgggtgtggacttc
gtggtgttcgcgccgcgctggctggtgggcgaggacaccttccggccgccgtacttccac
cggaacgtgatgagcgagtacatgggcctgatcgagggcgcctacgacgcgaaggcggaa
ggcttcgtgccgggcggcggttcgctgcacaacatgatgtcggcgcacggcccggaccgg
gagaccttcgaccgggcgagcgccgccgagctgaagccgcagcggatcgacgacggactg
gcgttcatgttcgagacacggtggccggtgaccctcactccccaggcggcccgcgccgag
cacctgcaaccgggctacgacgacgtctggcagggcctggagcggcacttccgccccttg
cactga

DBGET integrated database retrieval system