KEGG   Streptomyces coelicolor: SCO1724Help
Entry
SCO1724           CDS       T00085                                 

Gene name
SCI11.13
Definition
(RefSeq) Ser/Thr protein kinase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
1843788..1845440
Genome map
AA seq 550 aa AA seqDB search
MSGEPDGERVIAGRYRLLSPLGEGGMGTVWRARDEVLRREVAVKEVRAPAGLSQPDVGRM
YARLEREAWAAARISHPNVVTVYDVATDGGRPWIVMELVRGLSLADLLDAEGPLEPRRAA
LIGAEVLAALRAAHAAGVLHRDVKPANVLLANDGRVVLTDFGIARVEGSEALTMTGEVVG
SPEFLAPERALGRTPGAASDLWSLGVLLYATVEGVSPFRQGTPLSTLRAIVDEAVPPPRR
AGALGPVVEGLLRKDPAERLPAEEAERALRLVGAGGAPPGRGPRTGAPPSGAFAPTVVAA
HPGPPTAPTPPMPVPAAGDTSAAGAPGAPGGRDRRARAVLLVGLAVLVLALAGLTYSLLD
RSDGGGGTEGSGGSPGPGATSAATSGGAGEPSPPASSGTDGGQSGPAAQSVEVTVVGSRT
HYSGACPPPHDRAPAFTATFTVGRLPAEVGYRWVTADGSVSDPGWRTLSFPSGGERSRQD
GVVVTTHDDTGAFESAVRVEVRSPVRATSDAVAFSVTCGTGTETETGTGTPSGGASHSSS
PSAPSSSPSA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggagaacccgacggcgagcgtgtgatcgccggccgctaccggcttctgtcgccg
ctcggcgagggcggcatgggcaccgtgtggcgcgcccgcgacgaggtgctgcgccgcgag
gtcgccgtcaaggaggtgcgcgcccccgccggtctgtcgcagcccgacgtcgggcggatg
tacgcccggctggagcgggaggcgtgggccgccgcccggatctcccaccccaacgtggtc
acggtgtacgacgtggccaccgacggaggccggccctggatcgtgatggagctggtccgc
gggctgtccctggccgacctgctggacgccgagggcccgttggagccccgccgggccgcg
ctgatcggcgccgaggtgctggccgcgctgcgggccgcgcacgccgccggggtgctgcac
cgggacgtgaagccggccaacgtgctgctggcgaacgacggccgggtggtgctcaccgac
ttcgggatcgccagggtggagggcagcgaggcgctgaccatgaccggcgaggtcgtcggc
tcgcccgagttcctcgccccggagcgggcgctcggccgcacgcccggtgccgcgtccgac
ctgtggtcgctgggcgtgctgctgtacgcgacggtggagggggtctcgccgttccgtcag
ggcactccgctcagcaccctgcgcgcgatcgtcgacgaggcggtgccgccgccgcgccgg
gcgggtgcgctcgggccggtggtggagggcctgctgcgcaaggacccggccgagcggctc
ccggcggaggaggccgaacgcgcgttgcgcctcgtgggcgccggcggggcaccgcccggc
cggggcccgcgcaccggcgcgccgccgtccggcgcgttcgccccgacggtcgtggccgcc
cacccggggccgcccaccgcaccgacgccgccgatgcccgtaccggcggccggggacacc
tccgcggcgggtgcgcccggtgcgccggggggccgggaccggcgggcgcgggccgtactg
ctggtggggctggccgtgctggtcctggcgctggccggactgacgtactcgctgctggac
cgctcggacggcggtggcgggacggagggttcgggcgggagtccgggcccgggggccacg
tccgcggcgacgagcggcggcgccggggagccgagtcccccggcgtcctccgggaccgac
ggcgggcagagcggccccgcagcgcagtcggtggaggtgaccgtggtgggctcgcgcacc
cactactcgggggcctgtccgccgccgcacgaccgggcacccgcgttcacggcgacgttc
acggtcgggcggctgcccgcggaggtcggctaccggtgggtgaccgcggacgggtcggtc
tccgatccggggtggcggacgctgtccttcccgtcgggcggcgagcgctcgcgccaggac
ggcgtggtggtgacgacgcacgacgacaccggcgcgttcgagagtgccgtgcgcgtggag
gtgcggagtccggtgcgggccacgtccgacgcggtggcgttctcggtgacttgcgggacc
gggacggagacggagacggggacggggaccccgtcgggcggggcctcccactcctcgtct
ccctccgctccttcttcttctccttccgcctga

DBGET integrated database retrieval system