KEGG   Streptomyces coelicolor: SCO1724Help
Entry
SCO1724           CDS       T00085                                 

Gene name
SCI11.13
Definition
(RefSeq) Ser/Thr protein kinase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo RIO1 Phage_Coat_B
Motif
Other DBs
NCBI-GeneID: 1097155
NCBI-ProteinID: NP_625997
Kitasato: SCO1724
UniProt: Q9S2A6
Position
1843788..1845440
Genome map
AA seq 550 aa AA seqDB search
MSGEPDGERVIAGRYRLLSPLGEGGMGTVWRARDEVLRREVAVKEVRAPAGLSQPDVGRM
YARLEREAWAAARISHPNVVTVYDVATDGGRPWIVMELVRGLSLADLLDAEGPLEPRRAA
LIGAEVLAALRAAHAAGVLHRDVKPANVLLANDGRVVLTDFGIARVEGSEALTMTGEVVG
SPEFLAPERALGRTPGAASDLWSLGVLLYATVEGVSPFRQGTPLSTLRAIVDEAVPPPRR
AGALGPVVEGLLRKDPAERLPAEEAERALRLVGAGGAPPGRGPRTGAPPSGAFAPTVVAA
HPGPPTAPTPPMPVPAAGDTSAAGAPGAPGGRDRRARAVLLVGLAVLVLALAGLTYSLLD
RSDGGGGTEGSGGSPGPGATSAATSGGAGEPSPPASSGTDGGQSGPAAQSVEVTVVGSRT
HYSGACPPPHDRAPAFTATFTVGRLPAEVGYRWVTADGSVSDPGWRTLSFPSGGERSRQD
GVVVTTHDDTGAFESAVRVEVRSPVRATSDAVAFSVTCGTGTETETGTGTPSGGASHSSS
PSAPSSSPSA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggagaacccgacggcgagcgtgtgatcgccggccgctaccggcttctgtcgccg
ctcggcgagggcggcatgggcaccgtgtggcgcgcccgcgacgaggtgctgcgccgcgag
gtcgccgtcaaggaggtgcgcgcccccgccggtctgtcgcagcccgacgtcgggcggatg
tacgcccggctggagcgggaggcgtgggccgccgcccggatctcccaccccaacgtggtc
acggtgtacgacgtggccaccgacggaggccggccctggatcgtgatggagctggtccgc
gggctgtccctggccgacctgctggacgccgagggcccgttggagccccgccgggccgcg
ctgatcggcgccgaggtgctggccgcgctgcgggccgcgcacgccgccggggtgctgcac
cgggacgtgaagccggccaacgtgctgctggcgaacgacggccgggtggtgctcaccgac
ttcgggatcgccagggtggagggcagcgaggcgctgaccatgaccggcgaggtcgtcggc
tcgcccgagttcctcgccccggagcgggcgctcggccgcacgcccggtgccgcgtccgac
ctgtggtcgctgggcgtgctgctgtacgcgacggtggagggggtctcgccgttccgtcag
ggcactccgctcagcaccctgcgcgcgatcgtcgacgaggcggtgccgccgccgcgccgg
gcgggtgcgctcgggccggtggtggagggcctgctgcgcaaggacccggccgagcggctc
ccggcggaggaggccgaacgcgcgttgcgcctcgtgggcgccggcggggcaccgcccggc
cggggcccgcgcaccggcgcgccgccgtccggcgcgttcgccccgacggtcgtggccgcc
cacccggggccgcccaccgcaccgacgccgccgatgcccgtaccggcggccggggacacc
tccgcggcgggtgcgcccggtgcgccggggggccgggaccggcgggcgcgggccgtactg
ctggtggggctggccgtgctggtcctggcgctggccggactgacgtactcgctgctggac
cgctcggacggcggtggcgggacggagggttcgggcgggagtccgggcccgggggccacg
tccgcggcgacgagcggcggcgccggggagccgagtcccccggcgtcctccgggaccgac
ggcgggcagagcggccccgcagcgcagtcggtggaggtgaccgtggtgggctcgcgcacc
cactactcgggggcctgtccgccgccgcacgaccgggcacccgcgttcacggcgacgttc
acggtcgggcggctgcccgcggaggtcggctaccggtgggtgaccgcggacgggtcggtc
tccgatccggggtggcggacgctgtccttcccgtcgggcggcgagcgctcgcgccaggac
ggcgtggtggtgacgacgcacgacgacaccggcgcgttcgagagtgccgtgcgcgtggag
gtgcggagtccggtgcgggccacgtccgacgcggtggcgttctcggtgacttgcgggacc
gggacggagacggagacggggacggggaccccgtcgggcggggcctcccactcctcgtct
ccctccgctccttcttcttctccttccgcctga

DBGET integrated database retrieval system