KEGG   Streptomyces coelicolor: SCO1761Help
Entry
SCO1761           CDS       T00085                                 

Gene name
2SCI34.14c, SCI51.01c
Definition
(RefSeq) prephenate dehydrogenase
  KO
K04517  
prephenate dehydrogenase [EC:1.3.1.12]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO1761 (2SCI34.14c)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SCO1761 (2SCI34.14c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     SCO1761 (2SCI34.14c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1882015..1883100)
Genome map
AA seq 361 aa AA seqDB search
MRTALVIGTGLIGTSAALALTERGVTVHLADHDPEQARTAAALGAGTDEAPDGPVDLAVV
AAPPALVADVLADAMARGLARGYIDVASVKGGPRRELEARGLDLSAYIGTHPMSGREKSG
PLAATADLFEGRPWVLTPTRDTDTEVLNLALELVSHCRAVPVVMDADAHDRAVALVSHMP
HLVSSMVAARLEHAEEAAVRLCGQGIRDVTRIAASDPRMWIDILSANPGPVADLLTDVAA
DLEETVRALRALQSTDEDKRREGGTGIAEVLRRGNAGQVRVPGKHGSAPRSYETVAVLID
DQPGQLARIFADAGRAGVNVEDVRIEHATGQQAGLVQLMVEPKAAAVLTAALKERGWAIR
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaccgcactcgtcatcggcaccggcctcatcggcacctccgccgccctcgccctc
accgaacgcggtgtcaccgtccacctcgcggaccacgaccccgagcaggcccgcaccgcc
gcagcgctcggcgccggcaccgacgaggccccggacgggccggtcgacctcgccgtcgtc
gccgcaccgcccgccctggtggccgacgtgctcgccgacgccatggcccgcggcctcgcc
cgcggctacatcgacgtggccagcgtcaagggcggcccccggcgggagctggaggcgcgc
gggctcgacctctcggcgtacatcggcacccaccccatgtcaggacgggagaagtccggc
ccgctggccgccaccgccgacctcttcgagggccgtccctgggtgctgacccccacccgg
gacaccgacaccgaggtgctgaacctcgccctggagctggtctcgcactgccgcgcggtg
cccgtcgtgatggacgccgacgcccacgaccgcgccgtggccctcgtctcccacatgccc
cacctggtctccagcatggtcgccgcgcgcctggagcacgccgaggaggccgccgtacgg
ctgtgcgggcagggcatccgcgacgtgacccggatcgccgcctccgacccccggatgtgg
atcgacatcctctccgccaaccccgggccggtcgccgacctgctcaccgacgtcgccgcc
gacctggaggagacggtacgggccctgcgtgccctgcagtccaccgacgaggacaagcgc
cgcgagggcggcaccggcatcgccgaggtgctgcggcgcggcaacgccggacaggtccgc
gtccccggcaagcacgggtcggccccgcggtcctacgagacggtggccgtcctcatcgac
gaccagcccggtcagctggcccgcatcttcgcggacgcgggacgagccggggtcaacgtg
gaggacgtacggatcgagcacgcgaccgggcagcaggcgggtctggtgcagctcatggtg
gagccgaaggccgccgccgtcctcacggcggccctgaaggaacggggctgggcgatccgg
cagtga

DBGET integrated database retrieval system