KEGG   Streptomyces coelicolor: SCO1761Help
Entry
SCO1761           CDS       T00085                                 

Gene name
2SCI34.14c, SCI51.01c
Definition
(RefSeq) prephenate dehydrogenase
  KO
K04517  
prephenate dehydrogenase [EC:1.3.1.12]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO1761 (2SCI34.14c)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO1761 (2SCI34.14c)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SCO1761 (2SCI34.14c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     SCO1761 (2SCI34.14c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(1882015..1883100)
Genome map
AA seq 361 aa AA seqDB search
MRTALVIGTGLIGTSAALALTERGVTVHLADHDPEQARTAAALGAGTDEAPDGPVDLAVV
AAPPALVADVLADAMARGLARGYIDVASVKGGPRRELEARGLDLSAYIGTHPMSGREKSG
PLAATADLFEGRPWVLTPTRDTDTEVLNLALELVSHCRAVPVVMDADAHDRAVALVSHMP
HLVSSMVAARLEHAEEAAVRLCGQGIRDVTRIAASDPRMWIDILSANPGPVADLLTDVAA
DLEETVRALRALQSTDEDKRREGGTGIAEVLRRGNAGQVRVPGKHGSAPRSYETVAVLID
DQPGQLARIFADAGRAGVNVEDVRIEHATGQQAGLVQLMVEPKAAAVLTAALKERGWAIR
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaccgcactcgtcatcggcaccggcctcatcggcacctccgccgccctcgccctc
accgaacgcggtgtcaccgtccacctcgcggaccacgaccccgagcaggcccgcaccgcc
gcagcgctcggcgccggcaccgacgaggccccggacgggccggtcgacctcgccgtcgtc
gccgcaccgcccgccctggtggccgacgtgctcgccgacgccatggcccgcggcctcgcc
cgcggctacatcgacgtggccagcgtcaagggcggcccccggcgggagctggaggcgcgc
gggctcgacctctcggcgtacatcggcacccaccccatgtcaggacgggagaagtccggc
ccgctggccgccaccgccgacctcttcgagggccgtccctgggtgctgacccccacccgg
gacaccgacaccgaggtgctgaacctcgccctggagctggtctcgcactgccgcgcggtg
cccgtcgtgatggacgccgacgcccacgaccgcgccgtggccctcgtctcccacatgccc
cacctggtctccagcatggtcgccgcgcgcctggagcacgccgaggaggccgccgtacgg
ctgtgcgggcagggcatccgcgacgtgacccggatcgccgcctccgacccccggatgtgg
atcgacatcctctccgccaaccccgggccggtcgccgacctgctcaccgacgtcgccgcc
gacctggaggagacggtacgggccctgcgtgccctgcagtccaccgacgaggacaagcgc
cgcgagggcggcaccggcatcgccgaggtgctgcggcgcggcaacgccggacaggtccgc
gtccccggcaagcacgggtcggccccgcggtcctacgagacggtggccgtcctcatcgac
gaccagcccggtcagctggcccgcatcttcgcggacgcgggacgagccggggtcaacgtg
gaggacgtacggatcgagcacgcgaccgggcagcaggcgggtctggtgcagctcatggtg
gagccgaaggccgccgccgtcctcacggcggccctgaaggaacggggctgggcgatccgg
cagtga

DBGET integrated database retrieval system