KEGG   Streptomyces coelicolor: SCO1762Help
Entry
SCO1762           CDS       T00085                                 

Gene name
SCI51.02c
Definition
(RefSeq) chorismate mutase
  KO
K06208  chorismate mutase [EC:5.4.99.5]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO1762 (SCI51.02c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     SCO1762 (SCI51.02c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CM_1 T2SSM_b
Motif
Other DBs
NCBI-GeneID: 1097193
NCBI-ProteinID: NP_626033
Kitasato: SCO1762
UniProt: Q9S238
Position
complement(1883097..1883459)
Genome map
AA seq 120 aa AA seqDB search
MAVRAVRGAVQLERDEAGHMGEQVAALLTALMERNGLTADDLISLWFTATPDLHSDFPAA
AARGLGITDVPLICAQELDVEGAMPRVVRVLAHIESERPRTGIAHVYLGAAAALRKDIAQ
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtacgagcggtccggggcgccgtccaactggagcgggacgaggcggggcacatg
ggcgagcaggtcgcggccctgctgaccgccctcatggagcgcaacggcctgacggccgac
gacctgatcagcctgtggttcaccgccacccccgacctgcacagcgacttcccggccgcc
gcggcccgcggcctcggcatcaccgacgtgccgctgatctgcgcccaggagctggacgtc
gagggtgccatgccccgcgtcgtccgggtcctcgcccacatcgagtccgagcggccccgc
accgggatcgcccacgtctacctcggcgccgccgcggccctgcgcaaggacatcgcccag
tga

DBGET integrated database retrieval system