KEGG   Streptomyces coelicolor: SCO1762Help
Entry
SCO1762           CDS       T00085                                 

Gene name
SCI51.02c
Definition
(RefSeq) chorismate mutase
  KO
K06208  
chorismate mutase [EC:5.4.99.5]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO1762 (SCI51.02c)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO1762 (SCI51.02c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     SCO1762 (SCI51.02c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(1883097..1883459)
Genome map
AA seq 120 aa AA seqDB search
MAVRAVRGAVQLERDEAGHMGEQVAALLTALMERNGLTADDLISLWFTATPDLHSDFPAA
AARGLGITDVPLICAQELDVEGAMPRVVRVLAHIESERPRTGIAHVYLGAAAALRKDIAQ
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtacgagcggtccggggcgccgtccaactggagcgggacgaggcggggcacatg
ggcgagcaggtcgcggccctgctgaccgccctcatggagcgcaacggcctgacggccgac
gacctgatcagcctgtggttcaccgccacccccgacctgcacagcgacttcccggccgcc
gcggcccgcggcctcggcatcaccgacgtgccgctgatctgcgcccaggagctggacgtc
gagggtgccatgccccgcgtcgtccgggtcctcgcccacatcgagtccgagcggccccgc
accgggatcgcccacgtctacctcggcgccgccgcggccctgcgcaaggacatcgcccag
tga

DBGET integrated database retrieval system