KEGG   Streptomyces coelicolor: SCO1773Help
Entry
SCO1773           CDS       T00085                                 

Gene name
SCI51.13c
Definition
(RefSeq) L-alanine dehydrogenase
  KO
K00259  
alanine dehydrogenase [EC:1.4.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
Alanine, aspartate and glutamate metabolism
Taurine and hypotaurine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO1773 (SCI51.13c)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SCO1773 (SCI51.13c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.1  alanine dehydrogenase
     SCO1773 (SCI51.13c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1892493..1893608)
Genome map
AA seq 371 aa AA seqDB search
MKVGIPREVKNNEFRVAITPAGVHELVRHGHQVVVERNAGVGSSIPDEEYVTAGARILDT
ADEVWATADLLLKVKEPIAEEYHRLRKDQTLFTYLHLAASKECTDALIESRTTAIAYETV
ELPSRALPLLAPMSEVAGRLAPQVGAYHLMAANGGRGVLPGGVPGVLAGRAVVIGGGVSG
WNAAQIAIGLGFHVTLLDKDITKLREADKIFGTKIQTVVSNAFELEKACLEADLVIGAVL
IPGAKAPKLVTNELVSRMKPGSVLVDIAIDQGGCFEDSHPTTHAEPTFPVHNSVFYCVAN
MPGAVPNTSTYALTNATLPYIVELADRGWAEALRRDPALAKGLNTHDGKVVYREVAEAHG
LEHVELASLLA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcggcatcccccgcgaggtcaagaacaacgagttccgggtggccatcaccccc
gccggcgtgcacgagctggtgcgccacggtcaccaggtcgtcgtcgagcgcaacgccggc
gtcggctcctcgatccccgacgaggagtacgtcacggccggtgcgcggatcctcgacacc
gccgacgaggtctgggccaccgcggacctgctcctgaaggtcaaggagccgatcgcggag
gagtaccaccgcctgcgcaaggaccagacgctcttcacctacctgcacctggccgcctcc
aaggagtgcacggacgcgctcatcgagtcccgcaccaccgccatcgcgtacgagacggtc
gagctgcccagccgcgcgctgccgctgctggccccgatgtccgaggtcgcgggccgcctc
gccccccaggtcggcgcctaccacctgatggccgccaacggcgggcgcggtgtgctgccc
ggcggtgtccccggtgtgctcgcgggccgcgccgtcgtcatcggcggcggtgtctccggc
tggaacgcggcgcagatcgccatcggcctgggcttccacgtcaccctgctcgacaaggac
atcaccaagctcagggaagccgacaagatcttcggcacgaagatccagaccgtcgtctcc
aacgccttcgagctggagaaggcctgcctggaggccgacctcgtgatcggcgccgtgctc
atcccgggcgccaaggcaccgaagctggtcaccaacgagctggtgtcccggatgaagccc
ggaagtgtccttgtcgacatcgcgatcgaccagggcggctgcttcgaggactcccacccg
accacccacgccgagccgaccttcccggtccacaactcggtcttctactgcgtcgccaac
atgcccggcgcggtgcccaacacctccacctacgcgctgaccaacgccacgctgccgtac
atcgtggagctggccgaccgcggctgggccgaggcgctgcgccgcgaccccgcgctggcc
aagggtctcaacacccatgacggcaaggtcgtttaccgggaggtcgccgaggcacacggc
ctggagcacgtggagctcgcctcgctgctcgcctaa

DBGET integrated database retrieval system