KEGG   Streptomyces coelicolor: SCO1776Help
Entry
SCO1776           CDS       T00085                                 

Gene name
pyrG
Definition
(RefSeq) CTP synthetase
  KO
K01937  
CTP synthase [EC:6.3.4.2]
Organism
sco  Streptomyces coelicolor
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:sco00001]
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO1776 (pyrG)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     SCO1776 (pyrG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1896671..1898320)
Genome map
AA seq 549 aa AA seqDB search
MPPKSSTTKHIFVTGGVASSLGKGLTASSLGMLLKARGLRVVMQKLDPYLNVDPGTMNPF
QHGEVFVTNDGAETDLDIGHYERFLDRDLDGSANVTTGQVYSTVIAKERRGEYLGDTVQV
IPHITNEIKHRIRRMATDEVDVVITEVGGTVGDIESLPFLETVRQVRHEVGRDNVFVVHI
SLLPYIGPSGELKTKPTQHSVAALRNIGIQPDAIVLRCDREVPTAIKRKISLMCDVDEAA
VVACPDARSIYDIPKVIHTEGLDAYVVRRMDLPFRDVDWTTWDDLLDRVHNPEHEIVMAL
VGKYIDLPDAYLSVTEALRAGGFANKARVKIKWVTSDDCKTPAGARVQLGDVDAICIPGG
FGERGVTGKVGAIQYARENGIPLLGLCLGLQCIVVEAARNLAGVADANSTEFDPATAHPV
VSTMAEQLDIVAGEGDMGGTMRLGMYPAKLAEGSIVREVYDGKEYVEERHRHRYEVNNAY
RAELEKKAGIVFSGTSPDGKLVEYVEYPRDVHPYLVATQAHPELRSRPTRPHPLFAGLVK
AAVERKTSK
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaatcctcgacgaccaagcacatcttcgtcaccgggggtgtcgcctcctcg
ctcggcaaggggctcaccgcctccagcctcggcatgctgctcaaggccaggggcctgcgc
gtcgtgatgcagaagctcgacccgtacctgaacgtcgaccccggcacgatgaaccccttc
cagcacggtgaggtcttcgtcaccaacgacggcgccgagaccgacctggacatcggccac
tacgagcgcttcctcgaccgcgacctcgacggctcggccaacgtcaccaccggccaggtg
tactccacggtgatcgccaaggagcggcgcggcgagtacctgggcgacaccgtccaggtc
atcccgcacatcaccaacgagatcaagcaccgcatccgccgcatggcgacggacgaggtc
gacgtcgtgatcaccgaggtcggcggcaccgtcggcgacatcgagtcgctgccgttcctg
gagaccgtccgccaggtccggcacgaggtcggccgcgacaacgtgttcgtcgtgcacatc
tcgctcctgccctacatcggcccctcgggcgagctgaagaccaagcccacccagcacagc
gtcgccgccctgcgcaacatcggcatccagccggacgcgatcgtcctgcgctgcgaccgc
gaggtcccgaccgcgatcaagcgcaagatctccctgatgtgcgacgtcgacgaggcggcc
gtggtggcctgccccgacgcccgctccatctacgacattccgaaggtcatccacaccgag
ggcctggatgcctacgtcgtccgcaggatggacctgccgttccgcgacgtggactggacc
acctgggacgacctgctcgaccgggtccacaaccccgagcacgagatcgtcatggccctg
gtcggcaagtacatcgacctgcccgacgcctacctctcggtcaccgaggcgctgcgcgcg
ggcggcttcgccaacaaggcgcgggtgaagatcaagtgggtcacgtccgacgactgcaag
accccggccggcgccagggtccagctcggcgacgtcgacgcgatctgcatcccgggcggc
ttcggcgagcgcggtgtgaccggcaaggtgggcgcgatccagtacgcccgtgagaacggg
atcccgctgctcggcctctgcctcggcctgcagtgcatcgtcgtcgaggccgcgcgcaac
ctggccggtgtcgcggacgccaactccaccgagttcgaccccgccaccgcccacccggtc
gtctccaccatggccgagcagctggacatcgtggccggcgagggcgacatgggcggcacc
atgcggctcggtatgtacccggcgaagctggccgagggctccatcgtgcgcgaggtctac
gacggcaaggagtacgtcgaggagcggcaccgccaccgctacgaggtgaacaacgcctac
cgcgcggagctggagaagaaggccggcatcgtcttctcgggcacctccccggacggcaag
ctcgtcgagtacgtcgagtacccgcgcgacgtccacccctacctggtcgccacgcaggcg
cacccggagctgcgctcgcgcccgacccgcccgcacccgctcttcgccgggctggtcaag
gccgcggtcgagcggaagacgtcgaagtaa

DBGET integrated database retrieval system