KEGG   Streptomyces coelicolor: SCO1781Help
Entry
SCO1781           CDS       T00085                                 

Gene name
ppnK
Definition
(RefSeq) inorganic polyphosphate/ATP-NAD kinase
  KO
K00858  
NAD+ kinase [EC:2.7.1.23]
Organism
sco  Streptomyces coelicolor
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SCO1781 (ppnK)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     SCO1781 (ppnK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(1906323..1907228)
Genome map
AA seq 301 aa AA seqDB search
MTQNRVRTVFLLAHTGRPAAIRSAELVVKGLLRAGIGVRVLEAEARDLPLPGEVELVGEA
TPQCLDGCELLIVLGGDGTLLRGAEFARASGVPMLGVNLGRVGFLAEAERDDLDKVVDRV
VNRAYEVEERMTVDVVVHRNGDIVHTDWALNEAAVQKAGAEKLLEVVLEIDGRPVTGFGC
DGIVLSTPTGSTAYAFSAGGPVVWPEVEALLMVPISAHALFAKPLVTSPDSVLAVEVLPH
VPPGVLWCDGRRTVELPPGARVEVRRGAVPVRLARLHHASFTDRLVAKFALPVSGWRGAP
H
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttgacacagaatcgagtgcgtactgttttcctgctcgcccacaccgggcgccccgctgcc
atccgcagcgcggagctggtggtcaaggggctgctgcgggccgggatcggcgtacgggtc
ctggaggccgaggcgcgcgacctgccgctgccgggcgaggtggagctggtcggcgaggcc
accccgcagtgcctggacgggtgcgagctgctgatcgtgctgggcggcgacggcacgctg
ctgcgcggcgccgagttcgcccgcgcctcgggcgtgccgatgctcggcgtcaacctcggc
cgggtcggcttcctcgcggaggccgagcgcgacgacctcgacaaggtcgtcgaccgggtg
gtgaaccgggcctacgaggtcgaggagcggatgaccgtcgacgtcgtcgtccaccgcaac
ggcgacatcgtgcacaccgactgggcgctgaacgaggccgccgtgcagaaggcgggcgcc
gagaagctgctggaagtcgtgctggagatcgacggccggccggtgaccgggttcggctgc
gacggcatcgtgctgtcgacgccgaccgggtcgacggcgtacgccttctcggccgggggc
cccgtggtgtggcccgaggtggaggcgctgctgatggtgccgatcagcgcccacgcgctg
ttcgccaagccgctggtgacctcgccggactcggtgctcgcggtggaggtgctgccgcac
gtcccgccgggggtgttgtggtgtgacgggcggcggacggtggagctgccgccgggggcg
cgggtggaggtgcggcggggggcggtgccggtgcggctggcccggctgcatcacgcgtcg
ttcacggaccggctggtggcgaagttcgcgttgccggtctccgggtggcggggggcgccg
cactag

DBGET integrated database retrieval system