KEGG   Streptomyces coelicolor: SCO1808Help
Entry
SCO1808           CDS       T00085                                 

Gene name
SCI28.02
Definition
(RefSeq) phosphoserine phosphatase
  KO
K01079  
phosphoserine phosphatase [EC:3.1.3.3]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO1808 (SCI28.02)
   01230 Biosynthesis of amino acids
    SCO1808 (SCI28.02)
  Energy metabolism
   00680 Methane metabolism
    SCO1808 (SCI28.02)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO1808 (SCI28.02)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     SCO1808 (SCI28.02)
Protein phosphatases and associated proteins [BR:sco01009]
 HAD phosphatases
  Other HAD phosphatases
   SCO1808 (SCI28.02)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
1939010..1940242
Genome map
AA seq 410 aa AA seqDB search
MSASQTSDVPTLLVKIFGKDRPGITAGLFDTLAAYSVDVVDIEQVVTRGRIVLCALVTEP
PRGLEGDLRATVHSWAESLKLQAEIISGIGDNRPRGFGRSLVTVLGHPLTAEATAAIAAR
ITESGSNIDRIFRLAKYPVTAVEFAVSGVETEPLRTALATEAAALGVDIAVVAAGLHRRA
QRLVVMDVDSTLIQDEVIELFAAHAGCEDEVAEVTAAAMRGELDFEQSLHARVALLAGLD
ASVVDKVRAEVRLTPGARTLIRTLKRLGYQVGVVSGGFTQVTDALQEQLGLDFAQANTLE
IVDGRLTGRVTGEIVDRAGKARLLRRFAAAAGVPLSQTVAIGDGANDLDMLNAAGLGVAF
NAKPVVREAAHTAVNVPFLDTVLYLLGITREEVEAADTLADDLGDGPGRP
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcttcgcagacctctgacgttcccactctcctcgtcaagatcttcggcaaggac
cggccgggcatcacggccggcctgttcgacactctcgccgcgtactcggtcgatgtcgtc
gacatcgagcaggtcgtcacccgtggccggatcgtgctgtgcgcgctcgtgaccgagccg
ccccgcggtctggagggcgatctgcgggcgaccgtccacagttgggcggagtcgctgaag
cttcaggcggagatcatctccggcatcggcgacaaccggccgcgcggtttcggccgctcc
ctggtcacggtgctcgggcacccgctcaccgccgaggcgaccgccgccatagcggcccgg
atcaccgagtccgggagcaacatcgaccgtatcttccggctggccaagtacccggtgacc
gccgtcgagttcgcggtctccggcgtggagaccgaaccgctgcgcacggcgctggccacc
gaggccgcggcgctcggcgtggacatcgcggtcgtcgcggcagggctgcaccgccgggcg
cagcgcctggtcgtgatggacgtggactccacgctgatccaggacgaggtcatcgagctg
ttcgccgcgcacgccggctgcgaggacgaggtcgccgaggtgacggcggccgcgatgcgc
ggggagctggacttcgagcagtcgctgcacgcgcgcgttgccctgctggcggggctggac
gcctcggtggtggacaaggtgcgtgccgaggtgcggctgacgccgggtgcccgcaccctg
atccgcacgctgaagcggctcggctaccaggtgggggtcgtctccggcggcttcacccag
gtcaccgacgccttgcaggagcagctggggctggacttcgcgcaggccaacacgctggag
atcgtcgacggcaggctgaccggacgggtcaccggggagatcgtggaccgggcgggcaag
gcgcggctgctgcgccggttcgccgccgcggcgggcgtaccgctgtcgcagaccgtggcg
atcggtgacggtgccaacgacctggacatgctgaacgcggccggactcggggtcgccttc
aacgccaagccggtggtgcgcgaggcggcgcacaccgcggtgaacgtccccttcctcgac
acggtgctctatctgctgggcatcacccgcgaggaggtcgaggccgcggacacgctggcc
gacgatctcggcgacggccccggccggccctga

DBGET integrated database retrieval system