KEGG   Streptomyces coelicolor: SCO1859Help
Entry
SCO1859           CDS       T00085                                 

Gene name
SCI39.06
Definition
(RefSeq) hypothetical protein
  KO
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO1859 (SCI39.06)
  Amino acid metabolism
   00340 Histidine metabolism
    SCO1859 (SCI39.06)
   00350 Tyrosine metabolism
    SCO1859 (SCI39.06)
   00360 Phenylalanine metabolism
    SCO1859 (SCI39.06)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO1859 (SCI39.06)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SCO1859 (SCI39.06)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     SCO1859 (SCI39.06)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class II
   SCO1859 (SCI39.06)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
1992485..1993504
Genome map
AA seq 339 aa AA seqDB search
MRDDGAALVDLAVNVRAGTPPAWLREHVAASLGSLAAYPDGRAARAAVAARHGLPVERVL
LTAGAAEAFVLLARALKVRRPVVVHPQFTEPETALRDAGHTVGRVLLRAADGFRLDPAAV
PEDADLVVVGNPTNPTSVLHPADVLASLARPGRTLVVDEAFMDAVPGEREALAGRTDVPG
LVVLRSLTKTWGLAGLRIGYVLADPETVAGLERAQPLWPVSTPALAAAEACVAPRALAEA
AHAAHRVAADRDRLVAGLAVSAGAGVRVVGPAEGPFVLVGVPDGAAVRHRLRDLGYAVRR
GDTFPGLGGGWLRLAVRDRATTEGFLNALDRALTATEPA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgacgacggtgcggcgctggtggacctcgcggtgaacgtccgcgcgggcactccc
ccggcctggctgcgcgagcacgtcgccgcctcactcggttcgctcgcggcctacccggac
ggtcgggccgcgcgggcggcggtggcggcacggcacgggctgccggtggagcgggtgctg
ctgacggcgggcgcggcggaggcgttcgtgctgctggcgcgggcgctgaaggtgcgccgg
ccggtcgtggtgcacccccagttcaccgagcccgagacggcgctgcgggacgcggggcac
acggtcggccgggtgctgctgcgggcggcggacggcttccgcctcgaccccgccgccgtc
cccgaggacgccgacctggtggtggtcggcaacccgacgaacccgacctcggtgctgcac
ccggcggacgtactcgcgtcgctggctcggcccgggcggacgctggtcgtggacgaggcg
ttcatggacgcggtgccgggcgagcgggaggcgctggccgggcggacggacgtacccggg
ctcgtcgtgctgcgcagcctcaccaagacgtggggactggcggggctgcgcatcgggtac
gtcctcgcggacccggaaacggtcgccgggctggagcgcgcgcagccgctgtggccggtg
tccacgcccgcgctggcggcggccgaggcgtgcgtggcgccgcgggcgctggcggaggcc
gcccacgccgcccaccgcgtcgccgccgaccgggaccggctcgtcgccgggctggcggtg
tcggccggtgccggcgtgcgggtcgtcggaccggccgagggccccttcgtcctggtcggc
gtcccggacggggccgccgtacggcaccggttgcgcgacctggggtacgcggtccggcgc
ggggacacgttccccggtctgggcggcgggtggctgcggctggcggtacgggaccgggcg
acgacggagggcttcctgaacgccctggatcgcgcgctgacggcgacggaaccggcctga

DBGET integrated database retrieval system