KEGG   Streptomyces coelicolor: SCO1888Help
Entry
SCO1888           CDS       T00085                                 

Gene name
SCI7.06c
Definition
(RefSeq) dihydroxy-acid dehydratase
  KO
K01687  
dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO1888 (SCI7.06c)
   01230 Biosynthesis of amino acids
    SCO1888 (SCI7.06c)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO1888 (SCI7.06c)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO1888 (SCI7.06c)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     SCO1888 (SCI7.06c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(2022115..2023845)
Genome map
AA seq 576 aa AA seqDB search
MTPRKSPEELRSHQWYGTDGLRSFSHRARTRQLGYLPEEHLGKPVIAILNTWSDINPCHV
HLRDRAQAVKRGVWQAGGFPLEFPVSTLSETFQKPTPMLYRNLLAMETEELLRSYPVDGA
VLMGGCDKSTPALLMGAATVDLPAVFVPAGPMLPGHWRGETLGSGTDMWKYWDDKRAGLI
GDCEMQELESGLARSPGHCMTMGTASTLTAAAEALGVTVPGASSIPAVDSGHDRMAAAAG
LRVVELVHRDRRLSDILTADAFEDAVTTVLGLGGSTNAVIHLIAMAGRAGVTLTLDDFDR
IARTVPVLANVRPGGQTHLMEDFHFAGGLPGFLSRITDLLHLDRPTVAHDTLREQLDGAL
VHHDDVIRPRDNPVANEGGVAVLRGNLCPDGAVIKHIAAEPHLLKHTGPAVVFDDYKTMQ
RTINDPELGITADSVLVLRNAGPKGGPGMPEYGMLPIPDHLLKQGVRDMVRISDARMSGT
SYGACVLHVAPESYVGGPLALVRTGDSITLDVGARTLHLGVDDEELERRRAAWTPPPARY
ERGYGALYNEQITQADTGCDFEFLARPGKVQDPYAG
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgacccccaggaagtccccggaagagctgcgcagccaccagtggtacggcacggacggc
ctgcgctccttcagccaccgcgcccgcacccgccagctcggctacctgcccgaggaacac
ctcggcaagcccgtcatcgccatcctcaacacctggtccgacatcaacccctgccacgtc
cacctgcgcgaccgcgcccaggcggtcaagcggggcgtgtggcaggcgggcggtttcccg
ctggagttcccggtctcgacgctcagcgagaccttccagaagccgaccccgatgctctac
cgcaacctcctcgccatggagaccgaggagctgctgcgctcctacccggtcgacggcgcc
gtgctgatgggcggctgcgacaagtccacgcccgccctgctcatgggcgccgccacggtg
gacctgcccgcggtgttcgtccccgccgggcccatgctccccgggcactggcgcggcgag
accctcggctccggcaccgacatgtggaagtactgggacgacaagcgggccggcctcatc
ggcgactgcgagatgcaggaactggagagcggcctggcccgctcgcccggccactgcatg
acgatgggcaccgcctccaccctgaccgccgccgccgaggcactcggcgtcacggtcccc
ggggcctccagcatcccggccgtcgactccgggcacgaccggatggccgccgcggccgga
ctgcgcgtcgtcgaactggtccaccgggaccggagactgagcgacatcctcaccgccgac
gccttcgaggacgccgtcaccaccgtgctcgggctcggcggctccaccaacgccgtgatc
cacctgatcgccatggcgggccgcgcgggcgtcaccctcacgctcgacgacttcgaccgc
atcgcccgcaccgtcccggtgctggccaacgtccgccccggcggacagacccacctgatg
gaggacttccacttcgccggcggcctgcccggcttcctctcccgcatcaccgacctgctc
cacctggaccggcccacggtcgcgcacgacaccctgcgcgagcagctggacggcgccctc
gtccaccacgacgacgtcatcaggccccgcgacaacccggtcgcgaacgagggcggggtc
gccgtactgcgcggcaacctctgcccggacggcgccgtcatcaagcacatcgccgccgag
ccgcacctgctcaagcacaccggacccgccgtcgtcttcgacgactacaagaccatgcag
cgcaccatcaacgacccggagctgggtatcaccgccgacagcgtgctggtgctccgcaac
gccggtcccaagggagggccgggcatgcccgagtacggcatgctgcccatccccgaccac
ctgctcaagcagggcgtacgggacatggtccggatctccgacgcccggatgagcggcacc
agctacggcgcgtgcgtgctgcacgtggcccccgagtcgtacgtcggcggaccgctcgcc
ctggtgcgcaccggcgactccatcaccctcgacgtcggggcccgcaccctgcacctgggc
gtggacgacgaggagctggagcgccgccgggccgcctggacaccgccgcccgcccgctac
gagcgcggttacggcgcgctctacaacgaacagatcacccaggccgacaccggctgcgac
ttcgagttcctggcccgcccgggcaaggtgcaggacccgtacgccggctga

DBGET integrated database retrieval system