KEGG   Streptomyces coelicolor: SCO1888Help
Entry
SCO1888           CDS       T00085                                 

Gene name
SCI7.06c
Definition
(RefSeq) dihydroxy-acid dehydratase
  KO
K22186  
xylonate dehydratase [EC:4.2.1.82]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCO1888 (SCI7.06c)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.82  xylonate dehydratase
     SCO1888 (SCI7.06c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(2022115..2023845)
Genome map
AA seq 576 aa AA seqDB search
MTPRKSPEELRSHQWYGTDGLRSFSHRARTRQLGYLPEEHLGKPVIAILNTWSDINPCHV
HLRDRAQAVKRGVWQAGGFPLEFPVSTLSETFQKPTPMLYRNLLAMETEELLRSYPVDGA
VLMGGCDKSTPALLMGAATVDLPAVFVPAGPMLPGHWRGETLGSGTDMWKYWDDKRAGLI
GDCEMQELESGLARSPGHCMTMGTASTLTAAAEALGVTVPGASSIPAVDSGHDRMAAAAG
LRVVELVHRDRRLSDILTADAFEDAVTTVLGLGGSTNAVIHLIAMAGRAGVTLTLDDFDR
IARTVPVLANVRPGGQTHLMEDFHFAGGLPGFLSRITDLLHLDRPTVAHDTLREQLDGAL
VHHDDVIRPRDNPVANEGGVAVLRGNLCPDGAVIKHIAAEPHLLKHTGPAVVFDDYKTMQ
RTINDPELGITADSVLVLRNAGPKGGPGMPEYGMLPIPDHLLKQGVRDMVRISDARMSGT
SYGACVLHVAPESYVGGPLALVRTGDSITLDVGARTLHLGVDDEELERRRAAWTPPPARY
ERGYGALYNEQITQADTGCDFEFLARPGKVQDPYAG
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgacccccaggaagtccccggaagagctgcgcagccaccagtggtacggcacggacggc
ctgcgctccttcagccaccgcgcccgcacccgccagctcggctacctgcccgaggaacac
ctcggcaagcccgtcatcgccatcctcaacacctggtccgacatcaacccctgccacgtc
cacctgcgcgaccgcgcccaggcggtcaagcggggcgtgtggcaggcgggcggtttcccg
ctggagttcccggtctcgacgctcagcgagaccttccagaagccgaccccgatgctctac
cgcaacctcctcgccatggagaccgaggagctgctgcgctcctacccggtcgacggcgcc
gtgctgatgggcggctgcgacaagtccacgcccgccctgctcatgggcgccgccacggtg
gacctgcccgcggtgttcgtccccgccgggcccatgctccccgggcactggcgcggcgag
accctcggctccggcaccgacatgtggaagtactgggacgacaagcgggccggcctcatc
ggcgactgcgagatgcaggaactggagagcggcctggcccgctcgcccggccactgcatg
acgatgggcaccgcctccaccctgaccgccgccgccgaggcactcggcgtcacggtcccc
ggggcctccagcatcccggccgtcgactccgggcacgaccggatggccgccgcggccgga
ctgcgcgtcgtcgaactggtccaccgggaccggagactgagcgacatcctcaccgccgac
gccttcgaggacgccgtcaccaccgtgctcgggctcggcggctccaccaacgccgtgatc
cacctgatcgccatggcgggccgcgcgggcgtcaccctcacgctcgacgacttcgaccgc
atcgcccgcaccgtcccggtgctggccaacgtccgccccggcggacagacccacctgatg
gaggacttccacttcgccggcggcctgcccggcttcctctcccgcatcaccgacctgctc
cacctggaccggcccacggtcgcgcacgacaccctgcgcgagcagctggacggcgccctc
gtccaccacgacgacgtcatcaggccccgcgacaacccggtcgcgaacgagggcggggtc
gccgtactgcgcggcaacctctgcccggacggcgccgtcatcaagcacatcgccgccgag
ccgcacctgctcaagcacaccggacccgccgtcgtcttcgacgactacaagaccatgcag
cgcaccatcaacgacccggagctgggtatcaccgccgacagcgtgctggtgctccgcaac
gccggtcccaagggagggccgggcatgcccgagtacggcatgctgcccatccccgaccac
ctgctcaagcagggcgtacgggacatggtccggatctccgacgcccggatgagcggcacc
agctacggcgcgtgcgtgctgcacgtggcccccgagtcgtacgtcggcggaccgctcgcc
ctggtgcgcaccggcgactccatcaccctcgacgtcggggcccgcaccctgcacctgggc
gtggacgacgaggagctggagcgccgccgggccgcctggacaccgccgcccgcccgctac
gagcgcggttacggcgcgctctacaacgaacagatcacccaggccgacaccggctgcgac
ttcgagttcctggcccgcccgggcaaggtgcaggacccgtacgccggctga

DBGET integrated database retrieval system