KEGG   Streptomyces coelicolor: SCO1912Help
Entry
SCO1912           CDS       T00085                                 

Gene name
SCI7.30
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate synthase
  KO
K01714  
4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
sco  Streptomyces coelicolor
Pathway
Monobactam biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO1912 (SCI7.30)
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCO1912 (SCI7.30)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO1912 (SCI7.30)
Enzymes [BR:sco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     SCO1912 (SCI7.30)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
2048176..2049129
Genome map
AA seq 317 aa AA seqDB search
MELHCLAADTTPMTTDDDSAPFGRSLCAMVTPFTGSGALDLDGAQRLADRLVARGCDGLV
LSGTTGESPTTTDAEKAALVTAVREAVGDRAALVAGVGTADTRHTVELALAAEKAGADGL
LVVAPYYSRPPQDALEAHFREVADASGLPVMLYDIPGRTGTRIEPDTVVRLAAHPRIVAV
KDCAYDLLGTQKVLSRTGLAYYAGCDEQILPLYAIGAAGYVSTVANVVPELFRAVLDAFD
AGDTGRAALLQRRAVPLVESMMAAGLPGTVTAKALLGALGLPAGPVRAPLRSADRETTAG
LLAAYGELAADAGQSQA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtggagctacactgtctggccgccgacactactcccatgacgacagacgacgactccgcc
cccttcggccgcagcctgtgcgccatggtcacgcccttcaccggctccggcgctctcgac
ctcgacggtgcccagcggctcgccgaccggctggtcgcgcggggctgtgacggcctggtg
ctgtccggcaccacgggcgagtcgccgaccaccacggacgccgagaaggcggccctggtg
acggcggtcagggaggcggtcggggaccgcgcggcactcgtcgccggggtcggcaccgcg
gacacccggcacaccgtggaactggccctggcggccgagaaggccggcgcggacggactg
ctggtggtcgcgccgtactacagcaggccgccgcaggacgccctggaggcgcacttccgc
gaggtcgccgacgcgagcggcctgcccgtgatgctgtacgacatcccgggccgcaccggc
acccgtatcgaacccgacaccgtcgtccggctcgccgcgcacccgcgcatcgtcgccgtc
aaggactgcgcctacgacctcctcggcacccagaaggtgctgtcccgcaccggtctggcc
tactacgcgggctgcgacgaacagatcctccccctctacgcgatcggagcggcggggtac
gtcagcaccgtcgccaacgtcgtgccggagctgttccgggccgtcctcgacgccttcgac
gcgggcgacaccggccgggccgcgctgctccagcggcgggcggtcccgctcgtcgagtcg
atgatggcggccggtctgcccggcacggtcaccgccaaggccctcctcggcgcgctgggc
ctgccggcgggcccggtccgcgcaccgctgcggtccgcggaccgggagaccaccgccggt
ctgctggcggcctacggagaactggccgccgacgccggtcagtcccaggcgtag

DBGET integrated database retrieval system