KEGG   Streptomyces coelicolor: SCO1916Help
Entry
SCO1916           CDS       T00085                                 

Gene name
SCI7.34c
Definition
(RefSeq) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
  KO
K00674  
2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC:2.3.1.117]
Organism
sco  Streptomyces coelicolor
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO1916 (SCI7.34c)
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCO1916 (SCI7.34c)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.117  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
     SCO1916 (SCI7.34c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(2050524..2051513)
Genome map
AA seq 329 aa AA seqDB search
MTDTTAPRTSGAVAAGLATIAADGTVLDTWFPAPELSDEPGPSGTERLTAEQAAELLGGG
ATAAVGPDARRGVEVVAVRTVISSLDEKPVDTHDVYLRLHLLSHRLVKPHGQSLDGIFAH
LANVAWTSLGPVAVDDIEKVRLNARAEGLHLQVTSIDKFPRMTDYVAPKGVRIADADRVR
LGAHLSAGTTVMHEGFVNFNAGTLGTSMVEGRISAGVVVGDGSDIGGGASTMGTLSGGGN
VRIVIGERCLVGAEAGVGIALGDECVVEAGLYVTAGTRVTMPDGQVVKARELSGASNILF
RRNSVTGTVEARPNNAVWGGLNEILHSHN
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacgactgctccccgcaccagcggcgccgtggccgccggcctcgccacgatc
gccgccgacggcaccgttctcgacacctggttcccggcccccgaactgtccgacgagccc
ggcccctccggcaccgagcgcctcaccgccgaacaggccgccgaactcctgggcggcggc
gccaccgccgcggtcggtcccgacgcccgccgcggcgtcgaggtggtcgcggtccgcacg
gtcatctcctcgctggacgagaagccggtcgacacccacgacgtctacctgcgcctgcac
ctgctctcccaccgcctggtcaagccgcacggccagagcctggacggcatcttcgcccac
ctcgccaacgtcgcctggacctcgctcggcccggtcgccgtcgacgacatcgagaaggtc
cggctcaacgcccgcgccgagggcctgcacctccaggtcacctcgatcgacaagttcccc
cgcatgacggactacgtcgcccccaagggcgtccgcatcgccgacgccgaccgggtgcgg
ctcggcgcgcacctctccgcgggcaccacggtcatgcacgagggcttcgtcaacttcaac
gccggcacgctgggcacctcgatggtcgagggccgcatctccgcgggcgtcgtcgtcggc
gacggctccgacatcggcggcggcgcctccaccatgggcaccctctccggcggcggcaac
gtccggatcgtcatcggggagcgctgcctggtcggcgccgaggcgggcgtcggcatcgcc
ctgggcgacgagtgcgtggtggaggccggcctctacgtcaccgcgggcacccgcgtcacg
atgcccgacggccaggtcgtcaaggcccgcgaactctccggcgcctccaacatcctcttc
cgccgcaactcggtcaccggcacggtcgaggcccgcccgaacaacgcggtgtggggcggc
ctgaacgagatcctgcacagccacaactga

DBGET integrated database retrieval system