KEGG   Streptomyces coelicolor: SCO1935Help
Entry
SCO1935           CDS       T00085                                 

Gene name
SCC22.17, tktA1
Definition
(RefSeq) transketolase
  KO
K00615  
transketolase [EC:2.2.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO1935 (SCC22.17)
   01230 Biosynthesis of amino acids
    SCO1935 (SCC22.17)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO1935 (SCC22.17)
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    SCO1935 (SCC22.17)
Enzymes [BR:sco01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     SCO1935 (SCC22.17)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
2066713..2068800
Genome map
AA seq 695 aa AA seqDB search
MSTKPTTTDLEWTELDQRAVDTARVLAADAVQKVGNGHPGTAMSLAPAAYTLFQKVMRHD
PADANWVGRDRFVLSAGHSSLTLYTQLYLAGFGLELADLESFRTWGSKTPGHPEYGHTTG
VETTTGPLGQGVANAVGMAMAARYERGLFDPEAAEGESPFDHFVYCIAGDGCLQEGISSE
ASSTAGHQKLGNLVLLWDDNHISIEGDTETAVSEDTCKRYEAYGWHVQRVAPKPDGDLDP
NAIYDAIEAAKKVTDRPSFIAMRSIIAWPAPNAQNTEAAHGSALGDDEVAATKRVLGFDP
EKSFEVSDEVIEHTRKALEKGQAARAVWEKSFQQWRDNNPERAAEYDRVAKGELPAGWEE
KIPVFEAGKGLATRAASGKVLQALGAVIPELWGGSADLAGSNNTTIDKTSSFLPAGNPLP
EADPYGRTIHFGIREHAMAAEMNGIALHGNTRIYGGTFLVFSDYMRNAVRLSALMHLPVT
YVWTHDSIGLGEDGPTHQPVEHLASLRAIPGLNVVRPADANETAIAWREILRRWTKEFGK
GQPHGLALTRQGVPTYEPNEDAAKGGYVLFEAEGGDAEVVLIATGSEVHVAVGARERLQA
DGVPTRVVSMPSVEWFEQQDQGYRDSVLPPSVKARVAVEAGIGLTWHKYVGDAGRIVSLE
HFGASADAKVLFKEFGFTAENVASAARESLAAAQR
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccaagccgaccaccacagacctcgagtggaccgaactggaccagcgggccgtg
gacaccgcccgcgtcctggccgccgatgccgtacagaaggttggcaacggccatccgggt
acggcgatgagcctggcgcccgccgcctacaccctcttccagaaggtgatgcggcacgac
cccgccgacgcgaactgggtcgggcgcgaccgtttcgtgctgtccgcgggccactcgtcc
ctgaccctctacacccagctgtacctggccggtttcggcctggagctggcggacctggag
tccttccgcacctggggctccaagacccccggccacccggagtacggccacaccacgggc
gtggagaccacgaccggcccgctgggccagggtgtcgccaacgcggtgggcatggcgatg
gccgcccgctacgagcgcggcctgttcgacccggaggccgccgagggcgagtccccgttc
gaccacttcgtctactgcatcgccggtgacggctgcctccaggagggcatctcctccgag
gcgtcctcgacggccggtcaccagaagctcggcaacctggtgctcttgtgggacgacaac
cacatctccatcgagggcgacacggagaccgccgtctccgaggacacctgcaagcggtac
gaggcgtacggctggcacgtccagcgtgtcgcgccgaagccggacggcgacctggacccg
aacgcgatctacgacgcgatcgaggcggccaagaaggtcaccgaccgcccctccttcatc
gcgatgcgctcgatcatcgcctggcccgccccgaacgcgcagaacaccgaggccgcgcac
ggctcggcgctcggcgacgacgaggtcgcggcgaccaagcgggtcctgggcttcgacccg
gagaagtccttcgaggtctccgacgaggtcatcgagcacacccgcaaggccctggagaag
gggcaggcggcccgcgcggtgtgggagaagtccttccagcagtggcgggacaacaacccg
gagcgcgccgccgagtacgaccgcgtggccaagggtgagctgccggcgggctgggaggag
aagatcccggtcttcgaggcgggcaagggcctggcgacccgcgccgcgtccggcaaggtg
ctccaggcgctcggcgcggtgatcccggagctgtggggcggatcggccgacctcgcgggc
tcgaacaacacgacgatcgacaagacgtcgtccttcctcccggcgggcaacccgctgccg
gaggccgacccgtacggccgcaccatccacttcggcatccgcgagcacgcgatggcggcg
gagatgaacggcatcgcgctgcacgggaacacccgcatctacggcggaacgttcctggtc
ttctccgactacatgcgcaacgccgtgcgcctgtcggccctgatgcacctgccggtgacg
tacgtgtggacgcacgactccatcggtctgggcgaggacggcccgacccaccagccggtc
gagcacctggcctcgctgcgcgccatcccgggtctgaacgtggtccgcccggccgacgcc
aacgagacggcgatcgcctggcgggagatcctgcgccgctggacgaaggagttcggcaag
ggccagccgcacggtctggcgctgacccgccagggtgtgccgacgtacgagccgaacgag
gacgcggccaagggcggctacgtgctgttcgaggcggagggcggcgacgccgaggtcgtg
ctcatcgccaccggttccgaggtgcacgtggccgtcggggcgcgtgagcggctccaggcc
gacggcgtgccgacccgtgtggtgtccatgccgtccgtggagtggttcgagcagcaggac
caggggtaccgggacagcgtcctgcccccgtccgtgaaggcccgggtcgcggtcgaggcc
gggatcggtctgacctggcacaagtacgtgggagacgccggccgcatcgtctcgctggag
cacttcggtgcttcggcggacgccaaggtgctcttcaaggagttcggcttcaccgccgag
aacgtggcctccgccgcgcgggaatccctggccgcggcccagcgctga

DBGET integrated database retrieval system