KEGG   Streptomyces coelicolor: SCO1936Help
Entry
SCO1936           CDS       T00085                                 

Gene name
SCC22.18, tal2
Definition
(RefSeq) transaldolase
  KO
K00616  
transaldolase [EC:2.2.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO1936 (SCC22.18)
   01230 Biosynthesis of amino acids
    SCO1936 (SCC22.18)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO1936 (SCC22.18)
Enzymes [BR:sco01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     SCO1936 (SCC22.18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
2068835..2069953
Genome map
AA seq 372 aa AA seqDB search
MTDALKRLSDEGVAIWLDDLSRKRITSGNLAELIDQQHVVGVTTNPSIFQKAISQGDGYD
QQLADLAVRGVTVEEAIRMITTADVRDAADILRPVYDNTGGKDGRVSIEVDPRLAHNTHA
TVAEAKQLAWLVDRPNTFIKIPATEAGLPAIAETIGLGISVNVTLIFSLERYRKVMDAFL
TGLEKAKERGLDLSQIHSVASFFVSRVDTEIDKRIDALGTDEAKAQRGKAAVANARLAYQ
AYEEVFGTDRWAALEKAGANKQRPLWASTGVKDKAYSDTMYVTDLVAPNTVNTMPEATLL
ATEDHGEITGDAVAGSYERARADLDAIEKLGISYDEVVQLLEKEGVDKFEDAWNDLLKST
EAELKRLAPSKG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgcactcaagcgcctctccgatgaaggcgtggcgatctggctggacgacctg
tcgcgcaagcggatcacgtccggcaacctcgccgagctgatcgaccagcagcacgtcgtg
ggcgtcaccaccaacccgtcgatcttccagaaggccatctcgcagggcgacggctacgac
cagcagctcgccgacctcgccgtccgcggagtcacggtcgaagaggccatccgcatgatc
accacggcggacgtccgcgacgccgccgacatcctgcgccccgtctacgacaacaccggc
ggcaaggacggccgggtctccatcgaggtggacccgcggctggcgcacaacacccacgcc
acggtggccgaggccaagcagctggcgtggctggtggaccggccgaacaccttcatcaag
atcccggcgaccgaggcgggcctgccggccatcgccgagaccatcggcctgggcatcagc
gtcaacgtcacgctgatcttctccctggagcgctaccgcaaggtcatggacgccttcctg
accggcctggagaaggccaaggagcgtggcctggacctctcgcagatccactccgtggcg
tccttcttcgtgtcccgcgtggacaccgagatcgacaagcggatcgacgcgctcggcacc
gacgaggccaaggcgcagcgcggcaaggccgccgtcgccaacgcccgcctggcctaccag
gcgtacgaggaggtcttcggcaccgaccgctgggccgccctggagaaggccggcgccaac
aagcagcgtccgctgtgggcgtcgaccggtgtgaaggacaaggcgtacagcgacaccatg
tacgtcaccgacctggtcgcgccgaacacggtcaacaccatgccggaggccacgctgctg
gccaccgaggaccacggcgagatcaccggcgacgccgtcgccgggtcgtacgagcgggcc
cgcgcggacctcgacgcgatcgagaagctcgggatctcctacgacgaggtggtccagctc
ctggagaaggaaggcgtcgacaagttcgaggacgcctggaacgacctgctgaagtccacg
gaggcggagctcaagcgcctcgctccctcgaagggctga

DBGET integrated database retrieval system