KEGG   Streptomyces coelicolor: SCO1937Help
Entry
SCO1937           CDS       T00085                                 

Gene name
SCC22.19, zwf2
Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  
glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO1937 (SCC22.19)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO1937 (SCC22.19)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SCO1937 (SCC22.19)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     SCO1937 (SCC22.19)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     SCO1937 (SCC22.19)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SCO1937 (SCC22.19)
  Exosomal proteins of colorectal cancer cells
   SCO1937 (SCC22.19)
  Exosomal proteins of bladder cancer cells
   SCO1937 (SCC22.19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
2069957..2071480
Genome map
AA seq 507 aa AA seqDB search
MSSSNPLRDPADRRLPRIAGPSGLVIFGVTGDLSRKKLMPAVYDLANRGLLPPGFSLVGF
ARRDWEHEDFAQVVHDAVKEHSRTPFREEVWQQLIQGMRFVQGTFDDDDAFERLRGTIEE
LDKAQGTGGNFAFYLSVPPKSFPVVIQQLKKHGLADQTNGSWRRAVIEKPFGHDLKSAEE
LNAIVHEVFGSDQVFRIDHYLGKETVQNILALRFANTMFEPIWNRSYVDHIQITMAEDIG
IGGRAGYYDGIGAARDVIQNHLLQLLALTAMEEPASFDADALAAEKTKVLGAVRLPKDLG
RDTVRGQYAAGWQGGAKAVGYLEEDGIDPKSKTDTYAAIKVGIDNRRWAGVPFYLRTGKR
LGRRVTEIAVVFQRAPHSPFDTTATEELGSNAIVIRVQPDEGVTVRFGSKVPGTSMEIRD
VSMDFAYGESFTESSPEAYERLILDVLLGDANLFPRTEEVELSWKILDPIEEYWDEHGTP
AQYPAGTWGPVEADDMLERDGRSWRRP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaagcagcaatccgctgcgtgaccccgcagaccgacggctcccgcgcatcgcgggg
ccgtcgggtctggtcatcttcggcgtcaccggcgatctgtcccgcaagaagctcatgccc
gccgtgtacgacctcgccaaccggggtctgctgccgccgggcttctcgctcgtcgggttc
gcccgccgggactgggagcacgaggacttcgcccaggtcgtgcacgacgccgtcaaggag
cactcccgcacgccgttccgcgaggaggtctggcagcagctcatccaggggatgcgcttc
gtgcagggcaccttcgacgacgacgacgccttcgagcggctgcgcggcaccatcgaggag
ctggacaaggcacagggcacgggcggcaacttcgccttctacctgtcggtgccgccgaag
tccttcccggtggtcatccagcagctcaagaagcacggactggccgaccagacgaacggc
tcctggcggcgggcggtgatcgagaagcccttcggccacgacctgaagtcggccgaggag
ctgaacgccatcgtccacgaggtcttcggctccgaccaggtcttccgcatcgaccactac
ctgggcaaggagaccgtccagaacatcctggcgctgcgcttcgccaacacgatgttcgag
ccgatctggaaccggtcctacgtcgaccacatccagatcaccatggccgaggacatcggc
atcggcggccgggccggctactacgacgggatcggcgcggcgcgtgacgtcatccagaac
cacctgctccagctgctcgcgctgaccgcgatggaggagcccgcctccttcgacgcggac
gcgctggcggcggagaagaccaaggtgctcggcgcggtccgcctccccaaggacctgggc
cgggacaccgtgcgcggccagtacgcggcggggtggcagggcggcgccaaggccgtcggt
tacctcgaagaggacggcatcgaccccaagtcgaagaccgacacctacgccgcgatcaag
gtgggcatcgacaaccgccgctgggcgggtgtccccttctacctgcgcaccggcaagcgg
ctgggccgccgggtcacggagatcgcggtcgtcttccagcgggccccgcactcccccttc
gacacgacggccaccgaggaactcggctcgaacgcgatcgtcatccgcgtccagcccgac
gagggcgtcaccgtccgcttcggttccaaggtgccgggcacgtcgatggagatccgggac
gtgtcgatggacttcgcctacggcgagtccttcaccgagtccagcccggaggcgtacgag
cgcctgatcctggacgtcctgctcggcgacgccaacctcttcccgcgcaccgaggaggtc
gagctgtcctggaagatcctcgacccgatcgaggagtactgggacgagcacggcaccccg
gcccagtacccggccggcacctgggggcccgtcgaggcggacgacatgctggaacgagac
ggacggagctggcgccggccatga

DBGET integrated database retrieval system