KEGG   Streptomyces coelicolor: SCO1939Help
Entry
SCO1939           CDS       T00085                                 

Gene name
SCC22.21
Definition
(RefSeq) 6-phosphogluconolactonase
  KO
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO1939 (SCC22.21)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO1939 (SCC22.21)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     SCO1939 (SCC22.21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
2072529..2073314
Genome map
AA seq 261 aa AA seqDB search
MSDTPQLVVHRDKELMAEAAAARLITKIVDAQASRGSASVVLTGGRNGNGLLAALAGSPA
RDAIDWSRLDLWWGDERFLPEGDPERNVTQAQQALLDSVPLDPKRVHAMAASDGPYGSDV
EAAAAAYAQELATASVPENHAAVPSFDVLLLGVGPDTHVASLFPEHPGVRETERTVIGVH
GSPKPPPIRISLTLPAIRAAREVWLLAAGEDKANAVAMALSGAGEIQAPAAGARGRARTL
WLLDSAAASQLPRSLYPPASA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaccccgcagctggtcgtgcaccgtgacaaggagctgatggccgaggccgcg
gcggcccgtctgatcacgaagatcgtggacgcgcaggcctcccggggcagcgcgtccgtg
gtcctcaccggcggccgcaacggcaacggcctgctcgcggcgctggccggctctccggcc
cgggacgcgatcgactggagccgcctcgacctgtggtggggcgacgagcggttcctgccg
gagggcgacccggagcgcaacgtcacccaggcgcagcaggcactcctcgactcggtgccg
ctggacccgaaacgggtgcacgcgatggcggcctccgacggcccctacggttcggacgtg
gaggcggcagcggcggcctacgcgcaggaactggccacggcctccgtccccgagaaccac
gccgcggtcccgtccttcgacgtcctgctcctcggcgtcggcccggacacccacgtggcg
tcgctcttcccggagcacccgggagtccgggagacggagcgcacggtgatcggcgtccac
ggctcccccaagccgccgcccatccgcatctccctgacccttcccgccatccgcgccgcc
cgtgaggtgtggctgctggcggcgggcgaggacaaggcgaacgcggtggcgatggccctg
tcgggcgcgggcgagatccaggccccggcagcgggcgcccggggccgcgcccgcaccctg
tggctcctggactcggctgcggcgtcccaactgccgaggtcgctgtacccaccggcttcg
gcgtag

DBGET integrated database retrieval system