KEGG   Streptomyces coelicolor: SCO1947Help
Entry
SCO1947           CDS       T00085                                 

Gene name
gap1, SCC54.07c
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO1947 (gap1)
   01230 Biosynthesis of amino acids
    SCO1947 (gap1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO1947 (gap1)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     SCO1947 (gap1)
Exosome [BR:sco04147]
 Exosomal proteins
  Proteins found in most exosomes
   SCO1947 (gap1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(2080143..2081153)
Genome map
AA seq 336 aa AA seqDB search
MTIRVGINGFGRIGRNYFRALLEQGADIEIVAVNDLGDTATTAHLLKYDTILGRLKAEVS
HTEDTITVDGKTIKVLSERNPADIPWGELGVDIVIESTGIFTKKADAEKHIAGGAKKVLI
SAPAKDEDITIVMGVNQDKYDPANHHVISNASCTTNCVAPMAKVLDENFGIVKGLMTTVH
AYTNDQRILDFPHKDLRRARAAAENIIPTTTGAAKATALVLPQLKGKLDGIAMRVPVPTG
SATDLVVELQREVTKDEVNAAFKKAADDGDLKGILFYTEDAIVSSDITGDPASCTFDSSL
TMVQEGKSVKILGWYDNEWGYSNRLVDLTVFVGNQL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatccgcgtaggcatcaacggctttggccgcatcggtcgtaactacttccgcgcg
ctgctggagcagggtgcggacatcgagatcgtggctgtcaacgacctgggtgacaccgcg
accaccgcccacctgctgaagtacgacaccatcctcggccgcctcaaggcggaggtctcg
cacaccgaggacaccatcaccgtcgacggcaagaccatcaaggtcctgtccgagcgcaac
ccggccgacatcccgtggggtgagctgggcgtcgacatcgtgatcgagtcgaccggcatc
ttcacgaagaaggcggacgccgagaagcacatcgccggcggcgcgaagaaggtcctcatc
tcggccccggccaaggacgaggacatcaccatcgtgatgggcgtcaaccaggacaagtac
gacccggcgaaccaccacgtcatctccaacgcctcctgcaccaccaactgcgtggcgccg
atggccaaggtcctcgacgagaacttcggcatcgtcaagggcctgatgacgacggtccac
gcgtacacgaacgaccagcgcatcctggacttcccgcacaaggacctgcgccgcgcccgt
gccgccgcggagaacatcatcccgaccaccacgggcgccgccaaggccaccgcgctggtc
ctgccgcagctcaagggcaagctcgacggcatcgcgatgcgcgtcccggtcccgaccggc
tcggccaccgacctggtcgtggagctccagcgcgaggtcaccaaggacgaggtcaacgcc
gcgttcaagaaggccgccgacgacggcgacctcaagggcatcctgttctacaccgaggac
gcgatcgtctcctcggacatcaccggcgacccggcctcctgcaccttcgactcctccctg
accatggtccaggagggcaagtcggtgaagatcctcggctggtacgacaacgagtggggc
tactcgaaccgcctcgtcgacctcacggtcttcgtcggcaaccagctctga

DBGET integrated database retrieval system