KEGG   Streptomyces coelicolor: SCO1961Help
Entry
SCO1961           CDS       T00085                                 

Gene name
aroQ, SCC54.21c
Definition
(RefSeq) 3-dehydroquinate dehydratase
  KO
K03786  
3-dehydroquinate dehydratase II [EC:4.2.1.10]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO1961 (aroQ)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO1961 (aroQ)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     SCO1961 (aroQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2099149..2099622)
Genome map
AA seq 157 aa AA seqDB search
MPRSLANAPIMILNGPNLNLLGQRQPEIYGSDTLADVEALCVKAAAAHGGTVDFRQSNHE
GELVDWIHEARLNHCGIVINPAAYSHTSVAILDALNTCDGLPVVEVHISNIHQREPFRHH
SYVSQRADGVVAGCGVQGYVFGVERIAALAGAGSARA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgcagcctggccaacgccccgatcatgatcctcaacggccccaacctgaacctg
ctcggccagcgccagccggagatctacggctccgacaccctcgccgacgtcgaggcgctg
tgcgtgaaggcggcggccgcgcacggcggcacggtggacttccggcagtccaaccacgag
ggcgaactggtcgactggatccacgaggcccggctgaaccactgcgggatcgtgatcaac
cccgccgcctactcgcacacgtccgtcgccatcctggatgcgctcaacacctgcgacggg
ctgccggtggtggaggtccacatctccaacatccaccagcgtgagccgttccggcaccac
tcctacgtctcgcagcgcgccgacggcgtcgtcgcggggtgcggtgtgcaggggtacgtc
ttcggtgtggagcggatcgccgccctggccggggcgggctcggccagggcctga

DBGET integrated database retrieval system