KEGG   Streptomyces coelicolor: SCO1977Help
Entry
SCO1977           CDS       T00085                                 

Gene name
SC3C9.12
Definition
(RefSeq) oxidoreductase
  KO
K00266  
glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
sco  Streptomyces coelicolor
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO1977 (SC3C9.12)
  Energy metabolism
   00910 Nitrogen metabolism
    SCO1977 (SC3C9.12)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO1977 (SC3C9.12)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     SCO1977 (SC3C9.12)
    1.4.1.14  glutamate synthase (NADH)
     SCO1977 (SC3C9.12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
2115989..2117479
Genome map
AA seq 496 aa AA seqDB search
MADPKGFLTTPREEWPRRPAGERVRDWDEVYVPGALLPIVGRQADRCMDCGVPFCHEACP
LGNLIPEWNDLVSRSDWRAASERLHATNNFPEFTGRLCPAPCEAGCVLAINQPAVTIKNV
ECAIADTAWEEGFVPPLPPERLSGRTVAVIGSGPAGLAAAQQLTRAGHTVAVYERDDRIG
GLLRYGIPAFKMEKRHLERRVGQMRAEGTRFRTSAAVGRDVDAAALRTRYDAVVIATGAT
AWRELTVPGRELAGVHQAMEYLPLANRVCEGDLERSPLSAAGRHVVVVGGGDTGADCLGT
AVREGAASVTQLDIYARPGAERDERAEPWPTYPRLYRLSAAHEEARDLRSAPAADADARL
FAASTLRFTGDERGHVRALHLVGVDTGRRPLPGSERSLPADLVLLALGFSGPDRHDGLVD
GLGLDMEPRGTITRDRGFATNVPGVFAAGDAARGQSLVVWAIAEGRAVAAAVDRHLSGGS
TRLPAPVGPYDRPMTA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcccaagggttttctgacgacgccccgcgaggagtggccccgcagaccggcc
ggcgagcgggtccgggactgggacgaggtgtacgtcccgggagcgctgctgccgatcgtc
ggccggcaggccgaccggtgcatggactgcggcgtccccttctgccacgaggcctgtccg
ctgggcaacctgatcccggagtggaacgacctggtctcccggtcggactggcgggcggcg
agcgagcggctgcacgccacgaacaacttcccggagttcaccggccggttgtgtccggcg
ccgtgcgaggcgggttgtgtgctcgccatcaaccagcccgcggtcaccatcaagaacgtc
gagtgcgcgatcgcggacacggcctgggaggagggcttcgtcccgcccctgccgccggag
cggctgtccgggaggacggtggcggtgatcggctcgggaccggcggggctcgcggcggcg
cagcagttgacccgggccgggcacacggtcgcggtgtacgagcgcgacgaccggatcggt
gggctgctgcggtacgggatccccgcgttcaagatggagaagcggcacctggagcggcgt
gtcggccagatgcgggcggaggggacgaggttccgtacgtcggcggcggtcggacgggac
gtggacgccgcggcgctgcggacccgctacgacgcggtggtgatcgccaccggggcgacg
gcgtggcgggagctgaccgtgcccggccgggagctggcgggggtgcatcaggcgatggag
taccttccgctggccaaccgggtgtgcgagggcgacctcgagcgctccccgctgtccgcc
gccgggcggcacgtggtcgtcgtcggtggtggcgacacgggcgcggactgtctcggcacg
gcggtgcgggagggggccgcctccgtgacgcaactggacatctacgcgcggccgggtgcg
gagcgcgacgagcgggccgagccctggccgacctatccgcgcctgtaccggctgtcggcg
gcgcacgaggaggcacgcgacctgcggtccgcgccggcggcggacgcggacgcgcggctg
ttcgcggcgtccacgctccgcttcaccggcgacgagcgggggcatgtacgtgcgctgcac
ctggtcggggtggacacgggacgccgtccgctgcccggcagcgagcggtcgctcccggcg
gacctggtccttctcgccctcggcttctcggggcccgaccggcacgacgggctcgtcgac
gggctgggactggacatggagccccgtggcacgatcacccgggaccggggcttcgcgacc
aacgtcccgggggtgttcgccgccggggacgcggcgcgcgggcagtcactcgtcgtctgg
gcgatcgcggaggggcgggcggtggcggcggccgtggaccgccacctgtccggcggcagc
acccggctgccggccccggtcggcccgtacgaccggccgatgacggcctga

DBGET integrated database retrieval system