KEGG   Streptomyces coelicolor: SCO1996Help
Entry
SCO1996           CDS       T00085                                 

Gene name
coaE, SC7H2.10c
Definition
(RefSeq) dephospho-CoA kinase
  KO
K00859  
dephospho-CoA kinase [EC:2.7.1.24]
Organism
sco  Streptomyces coelicolor
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO1996 (coaE)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     SCO1996 (coaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2131391..2131993)
Genome map
AA seq 200 aa AA seqDB search
MLRVGLTGGIGAGKSEVSRLLVEHGAVLIDADRIAREVVAPGTPGLAAVVAAFGEDVLAE
DGSLDRPKLGSIVFADPEKLAVLNGIVHPLVRERSTALEEAAAEDAVVVHDVPLLTENGL
APLYDLVVVVDAAPATQLDRLMRLRGMTEQDARARMAAQATREQRREIADVVVDNDVPLE
ELRRRVEEVWDELVRGAHTE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgctgagggttggcctgaccggcgggatcggcgccggcaagagcgaggtgtcacggctc
ctcgtcgagcacggtgccgtactgatcgacgccgacaggatcgcgcgcgaggtcgtcgcc
cccggaacaccggggctcgccgcggtcgtggcggcgttcggcgaggacgtactggccgag
gacggcagcctggaccggccgaaactcggctcgatcgtgttcgccgaccccgagaagctg
gccgtcctgaacggcatcgtgcacccgctggtccgcgagcgctccactgccctcgaggag
gccgccgccgaggacgccgtcgtcgtccacgacgtccccctgctcacggagaacggcctg
gcgccgctgtacgacctcgtggtcgtcgtggacgccgcccccgccacccagctcgaccgg
ctgatgcggctgcgcggcatgaccgagcaggacgcacgggcccgcatggcggcccaggcg
acgcgcgagcagcgccgggagatcgcggacgtggtcgtcgacaacgacgtaccgctggag
gagctgcggcggcgcgtcgaggaggtctgggacgaactggtgcgcggggcgcacacggaa
tag

DBGET integrated database retrieval system