KEGG   Streptomyces coelicolor: SCO2019Help
Entry
SCO2019           CDS       T00085                                 

Gene name
SC7H2.33c
Definition
(RefSeq) chorismate mutase
  KO
K04092  
chorismate mutase [EC:5.4.99.5]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2019 (SC7H2.33c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     SCO2019 (SC7H2.33c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(2165374..2165724)
Genome map
AA seq 116 aa AA seqDB search
MTTSNTGTGAVEPAVREELARLRDSIDNIDAAVVHMLAERFKCTQQVGHLKARHQLPPAD
PAREAQQIARLRTLAESAKLDPAFAEKFLNFIVAEVIHHHERIAESNAAGGAPATD
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcaacaccggtaccggtgccgtcgaacccgccgtccgcgaggagctggcc
cggctgcgggacagcatcgacaacatcgacgcggccgtcgtccacatgctcgccgagcgc
ttcaagtgcacccagcaggtcggccacctcaaggcccgccaccagctgccgcccgccgat
ccggcccgcgaggcccagcagatcgcccggctgcgcaccctcgccgaaagcgccaagctc
gacccggcgttcgccgagaagttcctgaacttcatcgtcgccgaggtgatccaccaccac
gagcgcatcgcggagagcaacgccgccggcggcgcaccggccaccgactga

DBGET integrated database retrieval system