KEGG   Streptomyces coelicolor: SCO2026Help
Entry
SCO2026           CDS       T00085                                 

Gene name
gltB, SC3A3.04c
Definition
(RefSeq) glutamate synthase
  KO
K00265  
glutamate synthase (NADPH/NADH) large chain [EC:1.4.1.13 1.4.1.14]
Organism
sco  Streptomyces coelicolor
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
  Energy metabolism
   00910 Nitrogen metabolism
    SCO2026 (gltB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO2026 (gltB)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     SCO2026 (gltB)
    1.4.1.14  glutamate synthase (NADH)
     SCO2026 (gltB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(2171840..2176384)
Genome map
AA seq 1514 aa AA seqDB search
MDARPAAQGMYDPRNEHDACGVGFVATLTGEASHTLVDQALTVLRNLEHRGATGSEPDSG
DGAGILSQVPDAFFREVAGFELPEAGAYAVGIAFLPVDGTEDAVSRIETIAHEEGLTVLG
WREVPVAPQMLGATARSTMPVFRQVFVGDGASRGIALDRHAFALRKRAEREAGVYFPSLS
ARTIVYKGMLTTGQLEPFFPDLSDRRFASAIALVHSRFSTNTFPSWPLAHPYRFVAHNGE
INTVKGNRNWMRARESQLASNLFGSSADLERIFPICTPDASDSASFDEVLELLHLGGRSL
PHSVLMMIPEAWENHASMDADRRAFYQFHSTMMEPWDGPACVTFTDGTQVGAVLDRNGLR
PGRYWVTDDGLVVLGSEVGVLDIDPAKVVRKGRLQPGRMFLVDTAEHRIIEDDEIKAQLA
GEQPYGEWMEAGEIELSDLPEREHIVHTHASVTRRQQTFGYTEEELRVILAPMAKAGAEP
IGSMGTDSPIAALSERPRLLFDYFTQLFAQVTNPPLDAIREELVTSLRSSLGPQGNLLDP
TAASCRSVLLPFPVIDNDELAKLIHINADGDMPGFKAATLSGLYRVHGGGDALAARIEEI
CAEADAAIENGARLIVLSDRHSDAEHAPIPSLLLTAAVHHHLIGTKQRTQVGLLVEAGDV
REVHHVALLIGFGAAAVNPYLAMESVEDLVRAGTFLQTDDGEPEQAIRNLIYALGKGVLK
VMSKMGISTVASYRGAQVFEAVGLDEEFVAKYFHGTATKIGGVGIDVVAKEVAARHAKAY
PASGIAPAHRALDIGGEYQWRREGEPHLFDPETVFRLQHSTRSGTYDIFKKYTERVNEQS
ERLMTLRGLFGFKSGRQPISIDEVEPVSEIVKRFSTGAMSYGSISQEAHETLAIAMNQLG
GKSNTGEGGEDPERLYDPARRSSIKQVASGRFGVTSEYLVNADDIQIKMAQGAKPGEGGQ
LPGHKVYPWVAKTRHSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPQARIHVKLVSE
VGVGTVAAGVSKAHADVVLISGHDGGTGASPLTSLKHAGGPWELGLAETQQTLLLNGLRD
RIVVQTDGQLKTGRDVVIAALLGAEEFGFATAPLVVSGCVMMRVCHLDTCPVGIATQNPV
LRERFSGKAEYIVNFFRFIAEEVREILAELGYRSIEEAVGHAETLDVTRAVDHWKAQGLD
LEPLFHVPALTEGAVRHQAVGQDHGLEKALDNQLIKLASDALAAPDATRAAPVRAQVAIR
NINRTVGTMLGHEVTKKFGGGGLPDDTVDITFTGSAGQSFGAFVPRGITLRLEGDANDYV
GKGLSGGRIVVRPDRGADHLAEYSTIAGNTIGYGATGGEMFLRGKVGERFCVRNSGALVV
SEGVGDHGCEYMTGGHAVVLGETGRNFAAGMSGGIAYVVDLDRDNVNVGNVDAVQALDDA
DKDWLHDVVRRHAEETGSTVAGKLLADWPVAVERFSKIIPSTYQAVLAAKDAAERAGLSE
TETTEKMMEAATNG
NT seq 4545 nt NT seq  +upstreamnt  +downstreamnt
atggatgctcgccctgccgcgcagggtatgtacgacccccgcaacgaacacgacgcgtgc
ggcgtcggtttcgtcgccaccctcaccggcgaggcgtcccacaccctggtcgaccaggcg
ctcaccgtgctgcgcaacctggaacaccgcggcgccaccggctccgagcccgactcgggc
gacggcgccggcatcctctcccaggtgcccgacgcgttcttccgcgaggtggccggattc
gagctgccggaggccggggcgtacgccgtcggcatcgccttcctgccggtcgacggcacc
gaggacgccgtctcgcgcatcgagacgatcgcgcacgaggagggcctcaccgtcctcggc
tggcgcgaggtcccggtcgccccgcagatgctgggcgcgaccgcccgctccacgatgccg
gtcttccgccaggtcttcgtgggcgacggcgcctcgcggggcatcgccctggaccgccac
gccttcgcgctgcgcaagcgcgccgagcgcgaggccggtgtctacttcccgtcgctgtcc
gcgcggaccatcgtctacaagggcatgctgaccaccggccagctggaaccgttcttcccg
gacctgtccgaccgccgcttcgcctccgcgatcgcgctcgtgcactcccggttctccacc
aacaccttcccgtcgtggccgctcgcccacccgtaccgcttcgtcgcgcacaacggcgag
atcaacacggtcaagggcaaccgcaactggatgcgcgcccgcgagtcccagctggcctcg
aacctgttcggctcgtccgcggacctggagcggatcttcccgatctgtacgccggacgcc
tcggactccgcctccttcgacgaggtcctggaactgctccacctcggtgggcgctcgctg
ccgcactccgtgctgatgatgatcccggaggcgtgggagaaccacgcctccatggacgcg
gaccggcgcgccttctaccagttccactccacgatgatggagccctgggacggtcccgcc
tgcgtcaccttcaccgacggcacccaggtcggcgcggtcctcgaccgcaacggtctgcgc
cccggccgctactgggtcaccgacgacggcctcgtcgtcctcggctccgaggtcggcgtc
ctcgacatcgaccccgccaaggtcgtccgcaagggccgcctccagcccggccgcatgttc
ctggtggacaccgccgagcaccgcatcatcgaggacgacgagatcaaggcccagctcgcc
ggcgagcagccgtacggcgagtggatggaagccggcgagatcgagctgtccgacctgccc
gagcgcgagcacatcgtgcacacccacgcctcggtcacccgccgccagcagaccttcggg
tacaccgaggaggagctgcgcgtcatcctcgcgccgatggccaaggccggcgccgagccg
atcggctccatgggcaccgactcgccgatcgccgcgctctccgagcgcccccggctgctc
ttcgactacttcacccagctcttcgcccaggtcaccaacccgccgctggacgccatccgc
gaggaactggtcacctcgctgcgctcctcgctcggcccgcagggcaacctgctggacccg
acggccgcctcgtgccgcagcgtcctgctgcccttcccggtgatcgacaacgacgagctg
gccaagctcatccacatcaacgccgacggggacatgcccggcttcaaggccgcgaccctc
tccggtctctaccgggtgcacggcggcggcgacgcgctggccgcgcggatcgaggagatc
tgcgccgaggccgacgccgccatcgagaacggcgcccggctgatcgtcctgtccgaccgc
cactcggacgccgagcacgcgccgatcccctcgctgctgctcaccgcggccgtccaccac
cacctcatcggcaccaagcagcgcacccaggtgggcctgctggtcgaggccggcgacgtc
cgcgaggtccaccacgtcgccctgctcatcggcttcggcgccgccgcggtcaacccgtac
ctggcgatggagtccgtcgaggacctggtccgggcgggcaccttcctgcagaccgacgac
ggcgagcccgagcaggccatccgcaacctgatctacgcgctcggcaagggcgtcctcaag
gtcatgtccaagatgggcatctccaccgtcgcctcctaccgcggcgcccaggtcttcgag
gccgtcggcctcgacgaggagttcgtcgccaagtacttccacggcaccgccaccaagatc
ggcggcgtcggcatcgacgtcgtcgccaaggaggtcgccgcccgccacgccaaggcgtac
ccggccagcggcatcgcgccggcccaccgcgccctggacatcggcggcgagtaccagtgg
cgccgtgagggcgagccgcacctgttcgaccccgagacggtcttccgcctccagcactcc
acgcgctccggcacgtacgacatcttcaagaagtacaccgagcgggtgaacgagcagtcc
gagcggctgatgacgctgcgcggcctgttcggcttcaagagcggccggcagccgatctcc
atcgacgaggtcgagcccgtctccgagatcgtcaagcgcttctccaccggcgccatgtcg
tacggctccatctcccaggaggcgcacgagaccctcgccatcgccatgaaccagctgggc
ggcaagtccaacaccggtgagggcggcgaggacccggagcgcctgtacgacccggcgcgc
cggtccagcatcaagcaggtcgcctccggccgcttcggcgtcacctccgagtacctggtc
aacgccgacgacatccagatcaagatggcccagggcgccaagcccggcgagggcggccag
ctgcccggccacaaggtgtacccctgggtcgccaagacccggcacagcactcccggcgtc
ggcctgatctccccgccgccgcaccacgacatctactccatcgaggacctggcccagctg
atccacgacctgaagaacgcgaacccgcaggcgcggattcacgtcaagctggtctccgag
gtcggcgtcggcacggtcgcggcgggcgtgtccaaggcgcacgcggacgtggtgctgatc
tccggccacgacggcggcaccggtgcctccccgctcacgtcgctcaagcacgcgggcggc
ccctgggagctgggcctcgccgagacccagcagaccctgctgctcaacggtctgcgcgac
cggatcgtcgtccagaccgacggccagctcaagaccggccgcgacgtcgtcatcgccgcg
ctgctgggcgccgaggagttcggtttcgccaccgcgccgctcgtcgtctccggctgcgtc
atgatgcgcgtctgccacctggacacctgcccggtcggcatcgccacccagaacccggtc
ctcagggagcggttctccggcaaggccgagtacatcgtgaacttcttccggttcatcgcc
gaggaggtccgcgagatcctcgccgagctgggctaccgctccatcgaggaggccgtcggc
cacgccgagaccctcgacgtgacccgcgcggtcgaccactggaaggcacagggcctcgac
ctcgagccgctgttccacgtgcccgcgctgaccgagggtgcggtgcgccaccaggccgtc
ggccaggaccacggcctggagaaggcgctcgacaaccagctgatcaagctcgcctccgac
gcgctggccgccccggacgccacccgggccgccccggtgcgcgcccaggtcgcgatccgc
aacatcaaccgcacggtcggcaccatgctcggccacgaggtcaccaagaagttcggcggc
ggcgggctgcccgacgacaccgtcgacatcaccttcaccggctccgccggccagtccttc
ggcgccttcgtgccgcgcggcatcacgctgcgcctggagggcgacgccaacgactacgtc
ggcaagggcctgtccggcggccggatcgtcgtccgccccgaccggggcgccgaccacctc
gccgagtactccaccatcgccggcaacaccatcggctacggcgccaccggcggcgagatg
ttcctgcgcggcaaggtcggcgagcgcttctgcgtccgcaactccggcgcgctggtcgtc
tccgagggtgtcggcgaccacggctgcgagtacatgaccggcggccacgcggtcgtcctc
ggcgagaccgggcgcaacttcgcggccggcatgtccggcggcatcgcctacgtcgtcgac
ctcgaccgcgacaacgtcaacgtcggcaacgtcgacgcggtccaggccctggacgacgcc
gacaaggactggctgcacgacgtggtgcgccgccacgccgaggagaccgggtccacggtc
gccgggaagctgctcgccgactggcccgtcgccgtggagcgcttcagcaagatcatcccc
agcacgtaccaggcagtgctcgccgccaaggacgccgccgagcgagccggtctctccgag
accgagaccaccgagaagatgatggaggcggcgaccaatggctga

DBGET integrated database retrieval system